KEGG   Veillonella parvula: Vpar_1263Help
Entry
Vpar_1263         CDS       T01130                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
vpr  Veillonella parvula
Pathway
vpr00630  Glyoxylate and dicarboxylate metabolism
vpr01100  Metabolic pathways
vpr01110  Biosynthesis of secondary metabolites
vpr01120  Microbial metabolism in diverse environments
vpr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Vpar_1263
Enzymes [BR:vpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Vpar_1263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large
Motif
Other DBs
NCBI-ProteinID: ACZ24943
UniProt: D1BNI6
Position
complement(1442452..1443639)
Genome map
AA seq 395 aa AA seqDB search
MKDERFIVTYRIEASTYEEAKSIAWAVQVEQTIEFPYEFVTDPYIKETITGRLESLGPMV
EDSPYINVGVMSNAVIDTSRYYLARISYHVDTTALEATQFLNVVFGNSSLQPHIWVVDIE
LCPTLYDVFKGPRFGLQGIRRLVETPTRPMIQAVVKPMGTPNEELARMCGAYTRGGADVI
KDDHGISNQSFSQYKDRVKRCAAMVQEMNAAHGTHTLYAANVSGDGTDVLERAYFAKEVG
ATALMVAAGLVGFGWLHKLATDEKLRLPIIHHPAYSGGFVSSGVSGVADYLQLGLLPRIF
GADMPIFVSYGGRFTFTEKQCKRISSYIKRPMGLMKAACPAPGGGVTDARLNELVELYGN
DTMFLVGGDMFRRGPDIEVNMSYFVERLTKLSERT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgagcgatttatagttacatatagaatagaagcgagtacatatgaagaagca
aaatcaattgcttgggcggttcaagtagagcaaaccatagaatttccctatgagtttgta
acggatccatacattaaggaaactattactggtcgactagaatctcttggacctatggtg
gaagattctccatatatcaatgtaggtgtgatgtcaaatgctgtaattgatacctctcgt
tactatttggctcgtatttcatatcatgtagatactacagctttagaagcaacacaattt
ttaaatgttgtctttggcaattcttcgttacagcctcatatttgggtggtggatattgag
ctatgtccaacactttacgatgtgtttaagggcccacgatttggcttacaggggattcgt
cgtttagtggaaactccgacgcgcccaatgattcaagccgttgtaaagccgatgggaaca
ccaaatgaggaattggctcgcatgtgtggagcctatacacgtggtggggcagatgtcata
aaggatgatcatggtatttctaatcagtccttctctcaatataaagatcgtgtaaaacga
tgtgctgctatggtacaggaaatgaatgctgcacatggtacacatactttatatgctgca
aacgtatctggtgatggtacagatgtgttagaacgtgcttattttgctaaagaggttggt
gctactgctctcatggtggccgcaggtctcgttggtttcggttggttacacaaattagct
actgatgaaaaattacgattgcctattattcatcatcccgcttattctggtggatttgtg
agctctggtgtatctggtgtagccgattacttacaactaggtttattacctcgtattttt
ggggctgatatgccaatcttcgtatcttatggtggacgctttacttttacagagaagcaa
tgcaagagaatttcctcttacattaaacgaccaatgggcttgatgaaagcggcttgccct
gcaccaggtggtggcgttacagatgctcgtcttaatgaacttgttgagctgtacggaaat
gatacgatgttccttgttggaggcgatatgttccgcagagggccagatattgaggttaat
atgtcgtattttgtagagcgtctgactaaattatctgaaagaacgtaa

DBGET integrated database retrieval system