KEGG   Vitis vinifera (wine grape): 100246439
Entry
100246439         CDS       T01084                                 
Name
(RefSeq) cysteine and histidine-rich domain-containing protein RAR1
  KO
K13458  disease resistance protein
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    100246439
SSDB
Motif
Pfam: CHORD
Other DBs
NCBI-GeneID: 100246439
NCBI-ProteinID: XP_002269178
Position
16:complement(14377540..14384778)
AA seq 219 aa
MEEQAAKVRCQRMGCDVMFSPDDNPDDSCQYHDSGPFFHDGMKEWSCCKKRSHDFSLFLA
IPGCKTGKHTTEKPVLAKPAPPKNQVPAPAPAPDASSKQTCSRCQQGFFCSEHGSQAREK
RLQTDLPAENNTGVQEGLAAPAKKIVDINQPQTCGNKGCGMTFKEKDNHDTACSYHPGPA
VFHDRLRGWKCCDIHVKEFDEFMSIPPCTKGWHNANPAS
NT seq 660 nt   +upstreamnt  +downstreamnt
atggaggagcaggcggctaaggttagatgccagcgaatgggttgcgatgtcatgttctct
ccagatgacaatcctgatgattcctgtcaatatcacgattctgggcctttttttcatgat
gggatgaaagagtggagttgttgcaagaaaaggagtcatgatttcagcttatttctagca
attccaggatgtaagacaggtaagcacacaactgagaaaccagtactagcaaagccagct
cctccaaagaatcaagttcctgctccagctcctgcacctgatgcatcgtcaaaacaaact
tgctctaggtgtcagcagggatttttttgctcagaacatggttcacaagccagagaaaag
aggttgcaaacagatttgccagccgaaaacaacacaggtgttcaggagggcttggctgct
cctgcaaagaagattgttgatataaaccagccacaaacctgtggaaacaagggatgtggt
atgactttcaaagaaaaggataatcatgatactgcttgcagttatcatcctgggcctgca
gttttccatgaccggctaagagggtggaaatgctgcgacattcatgtgaaggagttcgat
gaattcatgagtataccaccttgcaccaagggatggcacaatgctaacccagcgtcataa

DBGET integrated database retrieval system