KEGG   Vitis vinifera (wine grape): 100247778
Entry
100247778         CDS       T01084                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00100  Steroid biosynthesis
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
Module
vvi_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100247778
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     100247778
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 100247778
NCBI-ProteinID: XP_002283576
UniProt: D7TJ17
Position
8
AA seq 367 aa
MYSLLYALAPSWTSAAILLTFFVYLAIAGSILPGKVVPGVILSDGTRLHYRCNGLLSLLL
LVGLLGVGVWMNYVSPTAISDRGLELLSATFIFSFLVTMLLYTAGCKSRNLGSSLKPHVT
GNLIYDWWFGIQLNPQFMGIDIKFFFVRAGMLGWLLINLSILAKRIQDANLSQSMILYQL
FCVLYILDYFFYEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLRNQVDLTTA
AIVANCFVFLMGYQVFRGANKQKHVFKKNPKALIWGKPPRVIGGKLLASGYWGIARHCNY
LGDLLLALSFSLPCGISSPVPYFYPTYLLILLVWRERRDEARCAAKYKEVWTEYCRLVPW
RILPYIY
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtattctcttctctacgctctggctccttcatggacttcagcggcgatactattgaca
ttcttcgtctacctggcgattgctggatctattctaccaggaaaggtggttcctggagtg
atcttatcagatggcactcgtctccattatcgctgcaatggcttattatctcttcttttg
ctggttgggctccttggtgttggggtttggatgaattacgtatcaccaacagcaatatca
gacagaggacttgagcttttatcggcaacctttatattcagttttcttgtgacaatgcta
ctttatacagctggttgcaagtcaaggaatctgggctcatctctaaagcctcatgtcacc
ggaaacttaatatatgactggtggttcgggatacagcttaatcctcagtttatgggcatt
gacatcaaatttttctttgtaagagctggaatgttaggatggctgcttatcaatctttcc
attctagcaaaaagaattcaggatgccaacttgagccaatcaatgatcctttaccagcta
ttctgtgtgctgtatatcctggactactttttttatgaggagtacatgacctccacatgg
gatatcattgcggagagattgggcttcatgttggtgtttggggatctagtgtggatccct
tttacttttagcatccagggttggtggcttttaagaaatcaagtggacctaacaacagct
gctattgttgcaaattgctttgtttttctgatggggtatcaagtgtttagaggggctaac
aaacaaaagcacgtgtttaagaagaatcccaaggcacttatttggggtaagcctccaaga
gttattgggggaaagttgcttgcgtctggttattggggaatcgcaaggcactgtaattac
cttggggacttgttgttggcactgtcctttagtttaccttgtgggataagttccccagtt
ccatatttttatcctacttatcttcttattctactagtatggagggaaagaagagatgaa
gctaggtgtgcagctaagtataaagaagtgtggacagagtactgtaggcttgttccatgg
agaatattgccatacatttactag

DBGET integrated database retrieval system