KEGG   Vitis vinifera (wine grape): 100264863Help
Entry
100264863         CDS       T01084                                 

Definition
(RefSeq) wall-associated receptor kinase 2
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
vvi  Vitis vinifera (wine grape)
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvi01001]
    100264863
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100264863
Protein kinases [BR:vvi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   100264863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Retrotran_gag_2 GUB_WAK_bind EGF_CA zf-CCHC RVT_2 Haspin_kinase EGF_3 PIP49_C EGF zf-CCHC_5 zf-CCHC_4
Motif
Other DBs
NCBI-GeneID: 100264863
NCBI-ProteinID: XP_019071906
Position
18
AA seq 1178 aa AA seqDB search
MNQDLVRLDRFDGSNFTRWQDKVVAARKKREEDELICRGHILNALSDRLYDLYTNTYSAR
EIWEALENKYKAEEEGTKKFLISQYIDFKFFDEKPLLPQIHELQVIVNKLKVLKIELPEA
FQVGAIVAKLPSSWKGYRKRILHKSEDYSLEEIQKHLRIEEELRSRDKMAEESNGGTNKA
NAVSKANHPRGKNNNDKRNSGNYMSPKKNQEQFKGKKGPCFVCGKLGHYARECRYRKDLK
GVVVNAIDEEIIATLSDVCVVQGKVQGWWYDTCATVHVTYDKSLFKTFEDAKGDQEVQMG
NEGRSKVLGKGTIEVVFTSGKKVTLINVLYVPDMNKNLVSGDLLGKPGIKGVFESDVKTA
FLNGDLNEEVYMEQPEGWVFTLGGGVVSWGSKKQTCISHSTMEAEFIALAATGKEVEWLK
DLMMDIPFTANNVSTVSIHCDSQATLARLLLASAATVNGQAKEGCLDRCEAVIIPYPFGT
DEHCYLSPYFWVTSNHSSNPPKLLLGKPSPEGNNVQVLDISLEGELLILNYVSHDCYDSL
GEADSLYSYDSYLKPGQFNISSTKNKFTMVGCDTFAWFKGQRGHESYRTGCMSICDNITD
VQNGSCSRNGCCQTSIPDGLSAIDLTLGSFNNYSEIWEFNPCGYAFIVEESNFNFSSNDL
RDLKSKTELPMVFDWALDKETCQVDVNDQTNNACKGNSTCNKRITGWGYLCNCSEGYQGN
PYLEPGCQDIIECENSILNKCENPETCINTQGNYTCSCPMWYHGDGKIDGQRCIPNRLQM
IHVAMGIGIALVVLVAGSTWLYWALKKRRFVKLKKKYFQQNGGSELRQQLSGQGSTERIK
FFTSEELEKATKNYDESNIIGRGGFGTVYKGTLTDGRIVAIKKSKMVERIQGKGFINEVG
ILSQINHRHVIQLLGCCLETQVPLLVYEFINNGTLSDHIHDENKASAIMWETRLRIAIQT
AEALYYLHCVASTPIVHRDVKSSNILLDEEYNAKMCDFGASRLVPLDQNQLSTAVQGTPG
YLDPESLQTNRVTEKSDVYSFGVVLVELLTGKKALFFDRPKEQRILTIFFLFPLKDDSLF
QVLEDCIVNNGNHKQILKVAQLAQRCLSINGEDRPTMKEVMLELEMIRMIGENAEQNPEE
NTYLLGESYAHYYLGGGESSIATHSMTGSFLLPVSDAR
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagaccttgtgaggttggatcgttttgatggttccaacttcactaggtggcaa
gacaaggtggtggcggcaaggaagaagagggaggaggatgagctcatatgtaggggtcat
attttgaacgccttatccgataggctatatgatctctacaccaacacctattccgcgagg
gagatttgggaggctcttgaaaacaagtacaaagccgaggaagaaggtaccaaaaagttt
cttatttctcaatacatagatttcaaattttttgatgaaaagcctctcttgccacaaatt
catgagttgcaagtaattgtaaataagttgaaagttctcaaaattgaacttccggaggcc
ttccaagttggtgctattgtggctaaattaccatcaagttggaaaggttaccggaagagg
attctccacaagagtgaagattactccttggaagagattcaaaaacatcttcgcattgag
gaagaattgagatcaagagacaaaatggcggaagagtccaatggtgggactaacaaagcc
aatgcggtttcaaaggctaatcatcctagaggtaaaaataacaacgacaaaaggaattct
ggaaattatatgagccccaagaaaaatcaagagcaatttaagggcaagaaaggtccttgt
tttgtgtgtggaaaactcgggcattatgctagggagtgtaggtaccgaaaggacctaaaa
ggggttgtggtgaatgcaattgatgaggagatcattgcaacactaagcgatgtgtgcgtt
gtccaaggaaaggtgcaaggatggtggtatgatacttgtgccacagttcatgttacctat
gacaaatctcttttcaagacctttgaagatgcaaagggagatcaagaggttcaaatgggc
aatgaaggaagatccaaggtgcttggcaaaggcactattgaagttgtttttacctccggc
aaaaaggttacccttataaatgtattgtatgtccccgatatgaataaaaatttggttagt
ggggatttgcttggcaaaccgggtatcaaaggggtgtttgaatccgatgtcaaaacggca
ttcttgaatggggatctcaatgaggaggtctacatggaacaaccagaaggttgggtgttt
acacttggtggtggggttgtctcttggggatccaagaaacagacttgtatatcacactca
accatggaggcagagtttatagctttagctgcaactggaaaagaagttgagtggcttaag
gatctcatgatggacatcccttttactgcaaataatgtgtcaacagtgtcgatacattgt
gacagtcaagccactctagctcgtttgctattggcttcagctgcaacagttaatggtcaa
gccaaggaaggttgcctagacagatgtgaggctgttatcatcccatatccgtttggcaca
gatgagcactgttacctcagcccttatttctgggttactagtaaccattcgtccaaccct
cctaaactattattaggcaaaccatctccagagggaaacaatgtccaagtgctggatatt
tcgctggagggtgagttgctcatcttgaactacgtaagccatgactgttacgacagtctc
ggtgaggctgactccctctattcttacgattcctatctgaagccgggccaattcaacatc
tcgagtaccaaaaacaagttcactatggttggttgtgacacttttgcctggtttaaaggt
caaagaggtcacgaaagctacagaactgggtgcatgtcaatatgtgacaatatcacagat
gtccaaaatggatcttgctctagaaatggttgttgccagacctccatccctgatgggttg
tcggctatagatttgacactcggcagcttcaataattattctgaaatctgggaattcaat
ccctgcggctatgcctttattgtggaagaatctaacttcaatttctcctccaacgatcta
agagatttgaagagtaaaacggagctgcctatggtgtttgattgggcattggacaaggag
acatgtcaagtagatgtaaacgaccagaccaataacgcatgcaaggggaacagcacctgc
aacaagaggataacgggttggggctatctttgcaactgctcagagggttaccaagggaac
ccatacctggagcctggttgccaagatataattgaatgtgagaattccatcctcaacaag
tgtgaaaatccagaaacatgcatcaatacccaaggaaattatacttgttcttgccccatg
tggtaccatggagatggcaaaatcgatggtcaacgctgtattcccaatcgcttacaaatg
attcacgttgccatgggtattggaattgccttggtcgtattagtggcgggcagcacttgg
ctgtattgggctttgaagaaaagaaggttcgtcaaactcaaaaagaaatattttcaacaa
aacggtggttcagagcttcgacaacaactctcaggacaaggatctaccgaaagaattaaa
ttttttacctctgaagagcttgagaaagccaccaaaaattatgatgagagcaatataatt
ggtcgaggaggttttggcacagtttataaaggaactttaaccgatggtaggattgttgca
attaagaagtccaagatggtcgaacgaatccaaggcaaaggcttcataaatgaggtgggt
attctatctcaaataaatcatcgtcatgtgatacaactcttgggttgctgtttggaaaca
caagtgcctttactagtttacgagttcatcaacaatggcaccctctctgaccacatacat
gatgaaaataaggcatctgctattatgtgggaaactcgcttaaggattgccatccaaacc
gcggaagcactctattatttacattgtgtagcatctacgcctatcgttcatagagatgtt
aagtcttcaaatatactcttagatgaggagtacaatgcaaagatgtgtgactttggagct
tcaagattggttccattggatcaaaatcagttatctacagctgttcagggaactcctgga
tacttagaccctgagtctttgcagacaaaccgagtgactgagaaaagcgatgtttatagt
tttggagtggtccttgtagagctactcacaggaaagaaagcactgttttttgatagaccc
aaggagcagagaattctaactatatttttcctctttcccctgaaagatgacagcttattt
caggttcttgaggattgtatagtgaacaatggaaaccataagcagattttgaaagttgct
cagcttgcgcaaaggtgcctaagcataaacggggaggacagacccacaatgaaggaagta
atgttggaactagagatgataagaatgattggggaaaatgctgaacagaatccagaagaa
aatacatacttgcttggagaatcatatgctcactactatttgggtggtggtgaatcatcc
attgctacacatagcatgacgggcagtttcttgttaccagtaagtgatgcaagataa

DBGET integrated database retrieval system