KEGG   Vibrio vulnificus MO6-24/O: VVMO6_03900
Entry
VVMO6_03900       CDS       T01415                                 

Definition
(GenBank) ClpB protein
  KO
K11907  type VI secretion system protein VasG
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vvm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VVMO6_03900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vvm02044]
    VVMO6_03900
Secretion system [BR:vvm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VVMO6_03900
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_16 AAA_5 ClpB_D2-small AAA_22 Sigma54_activat NACHT AAA_25 AAA_7 IstB_IS21 AAA_30 Rad17 AAA_14 TniB ResIII RuvB_N Zeta_toxin TIP49 ABC_tran T2SSE DUF815 MutS_III
Other DBs
NCBI-ProteinID: ADV88922
Position
II:complement(1063835..1066399)
AA seq 854 aa
MASLSLSALVDKLTPEAKRALEQAAALASSRTHHSIEMTHWLLTLVQSAGPDEIELYRSF
KVDLNQLQTDFTLQLEKYKTGCQTVPGLSSHTVTILQNAWMTATIAFEAEKIAAVHLLHA
FLSDDTLFALSSTVSKELSKIQPSALIEYAQTHVEMANQIPNHRASTQALDQFTIDLTEQ
AELGQIDPVIGRDDEIRLMTDILLRRRQNNPILTGEAGVGKTAVVEGLALKIAQGDVPPA
LKAVRIKSLDLALLQAGAGMKGEFENRLKNVVKEVKESAVPIVLFIDEAHGLIGGGAQAG
QGDAANILKPALARGELRTIAATTWAEYKKYVEKDAALTRRFQVVKIEEPSPELAIEMLR
GLVPVMEKHHGVHITTEALKAAVFLSSRYISGRQLPDKAVSVLDTACSRVALSQNSIPGL
LDQKYKKRQMIEAQQLQLTNELAFGHSHQTALDELESKLSLLQNEIHQLETTWRDEEGAV
KQAKALRDSILAEPSAEKANQLQSIEQQLSSNPMPLVFSHVNEALIAEIIAGWTGIPLGK
LKSDEIKAILDLQQHLQERVVGQDHALSKMAEVIKTARAQLNEESKPNGIFFLVGPSGVG
KTESALAIAEQVYGSEENITVINMSEFKEEHKVSLLLGSPPGYVGYGEGGVLTEAVRRKP
YSVILLDEMEKAHPGVQDIFYQVFDKGMIKDGEGRDIDFKNTIIIMTSNSGTETTMELFQ
DPELAPDPEALKEALRDDLLQEFKPAFLGRVNVIPYIPLHRDVLEKITALKLSKIQKRIK
TNYKAEAVINDRLINSIVDSCNETGSGARALQNVIENKVLPKISESVLNAILNDIRINKI
EIEGEVDDLSISIV
NT seq 2565 nt   +upstreamnt  +downstreamnt
atggcatctctttcactatccgcgttagttgacaagttaacccctgaagcgaaaagagca
ttagagcaagccgctgctttggcgagctcaagaacccaccacagtattgaaatgacacat
tggctgcttacgctagtgcaaagtgctgggcctgatgaaatcgaactgtatcgttcgttt
aaggttgatctgaaccaactgcagacagatttcactttgcaattagagaagtacaaaacg
ggctgccaaactgtaccggggttgtcatcccatacggtcaccatactacagaatgcgtgg
atgacagcgacgatcgcgttcgaagcagaaaaaattgccgctgttcatttgcttcatgcc
ttcctctctgacgacacgttgtttgctctatcttcgactgtgagcaaagagctaagcaaa
attcagcctagtgcgctaatcgaatacgcacagactcatgttgaaatggcaaatcaaatt
cccaaccacagagcttctacacaagcgttggatcaatttacgatagatctgacagagcaa
gcagagctggggcaaattgatccggtgattggtcgcgatgatgaaattcggctgatgacg
gatattcttctgcgacgccgtcaaaataaccctatcctgacgggtgaggcgggggtcggt
aaaaccgccgttgtcgaaggacttgcgctaaaaatcgctcaaggggatgtgcctcccgcg
cttaaagcagtgagaattaaatcacttgatttggcgctactccaggccggtgctggtatg
aagggcgagtttgaaaatcggttgaagaacgtggtcaaagaagtcaaagagtctgcggta
cctatcgtactgtttatcgatgaagcgcatggattgattggtggaggggcgcaggctggt
caaggtgatgctgcgaacatacttaagcccgccttagccaggggggagctacgcacgatc
gccgcaaccacatgggctgaatacaaaaaatatgtagagaaagacgcagctctgacccgt
cgttttcaagtggttaaaatagaggaaccttcacctgaattggcgatagagatgctgcgt
ggcctcgttcctgtcatggaaaaacatcatggcgtccacattactaccgaggcactcaag
gctgccgtctttctttcttctcgctacattagcggccgtcagttgccagacaaggcggta
tcggttttagataccgcgtgctctcgtgttgctttgagtcaaaactcgataccagggctg
cttgatcagaaatacaaaaaacgccaaatgatagaagctcaacagcttcagctcaccaat
gaacttgcatttggtcattctcatcaaacagctcttgacgaacttgagagcaagttgtcg
ctccttcaaaatgaaattcaccaactagagacaacgtggcgagatgaagaaggcgcagtc
aagcaggccaaagcgctccgtgattccattttggcagaaccatctgcagagaaagccaat
cagctgcaatccattgaacagcagttatcgtctaacccgatgcctttggtgttttcgcat
gttaacgaagccctaatcgctgaaattattgcaggctggacaggcataccattaggcaaa
ctaaaaagcgatgaaataaaagcgattctagacttacagcaacatctgcaagagcgagtg
gtcggccaagatcacgcgttgagtaaaatggcggaagtgatcaaaaccgcgagagcacag
ctcaatgaagaatcaaaacctaacggtatctttttcttggtaggcccaagtggtgtcggt
aaaacggaatctgcgttggccattgctgagcaagtgtatggtagtgaagaaaacatcacc
gtcattaacatgtctgaatttaaagaagagcataaagtctcgttactgctgggctctcct
ccgggctacgttgggtatggcgaaggtggtgtgctaacggaagccgtaagaagaaaacct
tacagcgtcatattgcttgatgaaatggagaaagcccatccgggtgtacaggatattttc
tatcaagtgtttgataagggcatgattaaagacggtgaagggcgagacatcgatttcaaa
aacaccatcattatcatgacttccaactctgggacggaaacaacaatggagttattccaa
gatccagagcttgctccggatccggaggcactcaaagaagcgctacgagatgatttatta
caggaattcaagcccgcttttttaggtcgagtgaatgtcattccttatatccctttgcac
cgtgatgtattggagaaaatcaccgcgctgaaactctccaaaattcagaagaggataaaa
acaaactataaagcagaagcggtgatcaacgatcgcttaattaatagtattgttgacagc
tgcaatgaaacgggcagtggcgcgcgtgctcttcaaaatgtgattgaaaataaggtgctg
cctaaaatatctgaatccgtattaaatgccattcttaatgatataagaataaataaaatt
gagatagaaggtgaagttgatgacttgtctatctcaatcgtctaa

DBGET integrated database retrieval system