KEGG   Vibrio vulnificus CMCP6: VV2_0438
Entry
VV2_0438          CDS       T00108                                 

Definition
(GenBank) Uncharacterized protein ImpA
  KO
K11902  type VI secretion system protein ImpA
Organism
vvu  Vibrio vulnificus CMCP6
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vvu02044]
    VV2_0438
Secretion system [BR:vvu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VV2_0438
SSDB
Motif
Pfam: ImpA_N DUF3452 T6SS_VasJ
Other DBs
NCBI-ProteinID: AAO07392
UniProt: A0A3Q0KY27
Position
II:complement(473357..474490)
AA seq 377 aa
MSHHYEEFTWFEPALLPISAEQPAGVDPRSDITPQSLYYRLKDQRMQARNIERNAIIEEE
PILNYANLWQVFLDEVPQALTSQTKDLEYVAWLIEALTRLDGFKGMAVGYELATYYLENY
WADLYPMPDEDGLETRISPIIGLNGIDNEGTLIFPLSCIPMTEGLLEQPYAYWEYQQALD
LERCDEDKKRAKRDQGVPELSDITQAVKSSSSQFYQRLIEDLNRAISSFERFSQALDSAC
EEVTPSSYISRKLDAIHSAIMHLASDKMIKVSKETNSDEPSHSASSHEGEIDGRGQGEAN
FQLLAANMHSREQAIVHLQRVADFFRETEPHSPVSYTIEQVIRWCGMSLPELLAELISDG
DAKKGYFRLVGIADKNE
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgagtcatcactatgaggagttcacttggtttgagccggccttactgccaatttctgcc
gagcagccagcaggtgtggatccaagaagtgatattacgcctcagtcactctattaccga
ctgaaagaccagagaatgcaggcgagaaatattgagcgaaatgccattattgaagaagag
cctattcttaactatgccaacctctggcaagtgtttcttgatgaagttccgcaggcactg
acgtcacaaaccaaagatctcgagtacgtggcatggcttatcgaagcgttaactcgcctt
gatggttttaaaggaatggcggttggctatgagctggccacctactacttagaaaattat
tgggcagatctgtatccaatgccggatgaagatggcctagaaacaagaatttcgcccatc
atcggcctgaatggcatcgataatgaggggacgctcatttttccgttatcgtgcataccc
atgaccgaagggctgttagaacaaccttatgcgtattgggagtatcaacaagctttggac
ttggagcgctgtgatgaggacaagaaacgagccaaacgcgatcagggtgtccctgagtta
tctgacattacccaagccgtcaaatcgtcgagcagtcagttctaccaaagactgatagag
gatctaaatagagcgataagttcttttgaacgattttcacaggctttggatagtgcgtgt
gaagaagtcaccccaagttcctacatttctcgaaaattagatgcaatacactcggcaatt
atgcatttggcgagtgacaaaatgatcaaggtttcaaaagaaacgaattcagatgaacca
tcgcactctgcttctagtcacgaaggcgagatcgatggacgagggcagggcgaagctaat
tttcagttattggccgcaaatatgcactctcgtgaacaggccatagtgcatttgcaacga
gtggctgatttttttcgtgaaacagaaccgcattcacccgtttcatacacgattgaacaa
gtgattcgatggtgtggaatgtctttgccagaactcctggcagagcttatttccgatgga
gacgccaagaaaggctatttccgtttggttggcatagcagacaaaaatgagtaa

DBGET integrated database retrieval system