KEGG   Vibrio vulnificus CMCP6: VV2_0635
Entry
VV2_0635          CDS       T00108                                 

Definition
(GenBank) IncF plasmid conjugative transfer pilus assembly protein TraB
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
vvu  Vibrio vulnificus CMCP6
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vvu02044]
    VV2_0635
Secretion system [BR:vvu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VV2_0635
SSDB
Motif
Pfam: TrbI HSBP1 ALC Phasin Atg14
Other DBs
NCBI-ProteinID: AAO07578
UniProt: A0A3Q0KYI7
Position
II:684811..686292
AA seq 493 aa
MLDNWRKRLFSDTDGDFEQGGEINQRTASRNNTVTIIAVSALLLAALALYKYTRPPPPTQ
KESHQEPVEFGAIIEQDFVETDNQSALSLQQKTLSALEKQIADLTKSMRTHKEETERKIE
QAKEKTARLVEEQVREEFRNKEAQLQSRIDELEHNTSELVNTEPYSTIHTQRPMNSSETF
GQHKLPPRPIASSNNNPDMAQMQYQPSEQIPFNRNEFDSFNFFWESDETTYHRTTENYVP
TGTFVTAVVTGGADTNAGVLGQGDTTPVVFQTIHEGILPNGEKSKLSNCTITGSSYGEIS
SSRGIIRTNRLSCIQDEGHILDVAIKGTAFNFGRNGIRGTTILKNGEIVQMAGIAGILNG
IGETGQALSQTTSTSAFGTTSSINSQDAALNLLGNATSSVGEKLSDYYIGLAELYHPIVE
INPGAVVNIVFLEGFPLDPLMAEEYERQQLAEQSMSSQSNQILDVITNAPLNPLAKELST
QGIEVPPTPFGRK
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgctcgataactggagaaaacgcctttttagtgacacagatggcgactttgagcaaggt
ggcgagattaatcagcgcaccgcatcaagaaacaacaccgtcaccattatcgccgtctct
gccctgctccttgccgcactagcattgtataaatacactaggccgcctccccctacacaa
aaagaaagccatcaagaacctgtcgaatttggtgccatcattgagcaagattttgtcgaa
acagacaaccaatcggcgctctccctacagcaaaaaacgctgtctgccctagaaaagcaa
atagcggatttgaccaaatctatgcgcactcataaagaagagaccgagcgtaaaatcgag
caagcaaaagagaagaccgctcgcttagttgaggaacaagtacgtgaagagtttcgaaat
aaagaagcgcagcttcaatcccgtattgatgaactcgaacataacacttcggagttagtc
aataccgaaccatacagcaccatccacacccaaaggccgatgaatagctcagaaacattt
ggacagcacaagcttccgcctagacctattgcctcctctaacaacaaccccgatatggcg
cagatgcaatatcagccctcagagcaaatccctttcaatcgcaatgagtttgatagcttt
aatttcttttgggaaagcgatgaaacaacctatcaccgcaccactgagaactatgtgcca
actggaacctttgtcaccgcagtggtgacaggaggcgctgacaccaatgccggagtgctt
ggccaaggagacacgacccccgtggtctttcaaaccattcatgaaggtatcttacccaat
ggggaaaaatccaagctcagcaactgcaccattacaggttcatcctacggtgagatatcg
tcaagccgcggcattatccgcactaaccgcttgagctgtatccaagacgaagggcatatc
ttagacgtcgccatcaaaggaacggcgtttaactttggacgcaacggcatacgtggcacc
accatcttaaaaaatggtgagattgttcaaatggcggggattgccggtattttgaatggc
atcggcgagacaggtcaagcgctctcacaaaccacctccacctcagcattcggtacaacc
tcaagcatcaacagccaagatgcagcgttgaacttactcggcaatgctacctcaagtgtg
ggagaaaaactctccgattactacattggtcttgcagagctctatcaccccatcgtggaa
atcaacccaggtgccgttgtcaatattgtcttcttagaaggattcccgctggatcctctt
atggccgaagagtacgaacgccagcaattggcagagcaaagcatgtcgagtcaatcgaat
caaatcctcgatgtgatcactaatgccccccttaatccattggcgaaagagttgtctaca
caaggcattgaggttcccccaactccatttggccgcaaataa

DBGET integrated database retrieval system