KEGG   Xanthomonas citri pv. citri 306: XAC2614
Entry
XAC2614           CDS       T00084                                 
Symbol
virB4
Name
(GenBank) VirB4 protein
  KO
K03199  type IV secretion system protein VirB4 [EC:7.4.2.8]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XAC2614 (virB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xac02044]
    XAC2614 (virB4)
Enzymes [BR:xac01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     XAC2614 (virB4)
Secretion system [BR:xac02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   XAC2614 (virB4)
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_22 AAA_16 Septin DUF5789 RsgA_GTPase AAA_7 AAA_29 FtsK_SpoIIIE
Other DBs
NCBI-ProteinID: AAM37463
Position
complement(3079127..3081580)
AA seq 817 aa
MFSPDSPISEFVSISTHVAPSVVKTTAGDYLLIWHLGGLPFVGRDEFELEQRHNTFNRLL
QTLRAPDFANVAFWVHDVRRRRRIGAGGRFKQAFNQTLSDEYYTALSSQKIMQNELYFSM
IYRPVVTGRRLVEKSANPDKIRAEEEQAVAKVVELATNVEAVLKDYAPYRLGMYEAKNGL
VFSETLEFLGYLLNRIDEPVPVLPAPVPAYLPVSKHMFANKTGDFVIRTPDGINHFGAIL
NIKEYADGTYPGILNGLKYLDSEYVMTHSFSPVGRHDALKVLERTKGMMVSSGDKSSTQI
RDLDVAMDDVASGNFVLGEYHFTLAVYADSQEKLARQIATTRAELSNAGFVSAKEDLAIA
SSFYSQLPGNWRFRTRIANLSSLNFLGLSPLHNFAQGKQHNNPWGDCVTTLQTTNGQPYY
FNFHATHPSENSLGEKAIGNTMVIGKSGTGKTALINFLLSQVQKFDPIPTIFFFDKDRGA
EIFVRACGGNYLALENGSPTGFNPFQCERNEANTQFLAELIKVLGGKAEYSAREEEDIYR
AVEGMLDTPMHLRSMSNFRKSLPNMGDDGLYARLRRWTAGNSLGWVFDNPVDTIDLTRAS
IIGFDYTDVIDNAEVRVPVINYLLHRLEALIDGRPLIYVMDEFWKILDGKGGLKEFAKNK
QKTIRKQNGLGIFATQSPEDALASDIAAALIEQTATMILLPNPNASRDDYMEGLKLTDAE
YQVVVSLDERSRCFLVKQGHASAVCQLNLRGMDDALSVISSSTDNIEIMHQILAGKAGKL
GVTVDQLTPEQWLADFYANRKGSGKRKSAKDKEVEDA
NT seq 2454 nt   +upstreamnt  +downstreamnt
atgttcagcccagacagtccgatcagcgagtttgtttccatctcgacgcatgttgcgccg
tccgtcgtcaagacgaccgccggcgactacctgttgatctggcatctgggcggcttgccg
ttcgtggggcgagacgaattcgagctcgaacagcggcacaacacgttcaaccgtcttctg
cagactctgcgcgccccggatttcgccaacgttgcattctgggtccacgatgtacggcgt
cggcgcagaatcggtgcaggcggacgtttcaagcaggcattcaatcaaactctgtctgac
gaatattacacagcgctttcatcgcaaaagatcatgcagaacgagctgtatttcagcatg
atttacaggccggtagtcacgggacgtcgcttggtggagaaatccgcgaacccggacaag
attcgcgccgaggaagaacaggctgtcgcgaaagttgtcgaactggctactaatgtcgaa
gccgtgctcaaggattatgcgccgtaccgtctcggtatgtacgaggcaaagaacggcctg
gttttctccgagaccttggagtttctgggctacttgttgaaccgaatcgatgagcctgtg
ccggtcttgccagctccggtgcccgcgtatttgcccgtcagtaagcacatgttcgccaac
aagaccggcgatttcgtcattcgtactccagacggaatcaatcactttggcgccatcttg
aatatcaaggaatatgcggatggaacctatccgggcattctgaatggcctgaagtacctg
gattctgaatacgtcatgacccactcgttcagcccggtcggccgacacgatgcgctgaag
gtgttggaacgcaccaaggggatgatggtttcttcaggcgacaaatcgtcgacccagatc
cgcgatctcgatgtcgcgatggacgatgttgcctcgggaaacttcgtgctcggcgaatac
catttcacattggcggtctatgccgacagccaggagaagctggctaggcagatcgcaacc
acccgagccgaattgtccaatgccggcttcgtctcggccaaggaagatcttgcgatcgcc
tcgtcgttttattcgcagctgccaggtaactggcgcttccgtacgcgcatcgccaacctg
agctcgctgaacttccttggcttgtcgccgctgcacaattttgcccagggcaagcagcac
aacaatccatggggtgactgcgtcaccaccctgcagacaaccaatgggcagccgtactac
ttcaacttccatgcgacgcatccgtccgagaactcattgggagagaaggccatcggcaat
acgatggtgatcggcaagtcgggtaccggtaagacggcgctgatcaacttcctgttgagt
caggtgcagaagttcgacccgattccgaccatcttcttcttcgacaaggaccgcggcgcg
gagatcttcgtgcgcgcgtgcggtggcaactacctggcgctggaaaatgggtctccgact
ggcttcaaccctttccaatgcgagcgcaatgaagccaacacccaattcctggccgagttg
atcaaggtgctgggcggcaaggccgaatacagcgcccgtgaggaagaggacatctatcgc
gcggtggaaggcatgctggacacgccgatgcacctgcgcagcatgagcaatttccgcaag
agtctgcccaacatgggcgacgacggtctgtatgcgcgtctgcgccgctggaccgctggc
aattcgctcggttgggtgttcgacaatccggtggacacgatcgacctgacgcgggcgtcg
atcatcgggttcgactacaccgacgtgatcgacaacgctgaagtgcgcgtgccggtgatc
aactacctgctgcatcgcctggaagcgctgatcgacggccgcccgctgatctacgtgatg
gacgaattctggaagatcctggacggcaagggtggcctgaaggaatttgccaagaacaaa
cagaagaccatccgtaagcagaatggcttagggattttcgccacacagagccccgaagac
gcgctggccagtgacattgccgctgcattgatcgagcagacggccaccatgatcctgctg
ccgaacccgaatgccagccgcgacgattacatggaagggctcaagctcaccgacgccgaa
taccaggttgtggtgtcgttggatgagcgctcgcgctgtttcctggtcaagcagggccac
gcgtcggcggtgtgccagctcaacctgcgcgggatggatgacgcgctgtcggtgatttcc
tcgtccaccgacaatatcgagatcatgcaccaaattctggcgggcaaggccggcaagctg
ggcgtcaccgtggaccaactgacgccggagcaatggttggccgatttctatgccaaccgc
aagggctccggtaagcgcaagtcggccaaggacaaggaggtcgaagatgcatag

DBGET integrated database retrieval system