KEGG   Xenopus tropicalis (western clawed frog): 100135090Help
Entry
100135090         CDS       T01011                                 

Gene name
abcc3, abc31, cmoat2, mlp2, moat-d, mrp3
Definition
(RefSeq) ATP binding cassette subfamily C member 3
  KO
K05667  ATP-binding cassette, subfamily C (CFTR/MRP), member 3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100135090 (abcc3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100135090 (abcc3)
Transporters [BR:xtr02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    100135090 (abcc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 RsgA_GTPase MMR_HSR1 AAA_7 Zeta_toxin AAA_25 DUF815 Dynamin_N T2SSE
Motif
Other DBs
NCBI-GeneID: 100135090
NCBI-ProteinID: NP_001107301
Xenbase: XB-GENE-1003737
UniProt: A9JRK6
Position
10
AA seq 1531 aa AA seqDB search
METFCGSGDLGSQFWDSNLTLYTDNPDVTPCFQNTVLAWIPCVYLWVALPFYLLYLKYNR
RGYIVLSMLSKAKTVFGVLLWCVCWADLFYSFHGLVQNQSPPPVYFVTPLILGITMITAT
VLAQYERLRGVQSSGVLIIFWFLATVCAIIPFRSKVMASARQGQVTDKFRFTTFFLYFSL
LVIELLLSCFKEARPFFSPVRDEINPCPESDAGFLSRLTFWWFTKMAILGYKRPLEDKDL
WSLNEDDTSNVVVTNLIKEWEKEKSNLAQMQVSYSKKPEAVLNHTDEKAYESDVLIVDNK
KPKEPSFLKVLLRTFGPYFLIGSFFKLFQDLLSFVNPQLLSILITFIKNKDAPSWWGFCI
AVLMFLTSLVQTLILHQHFQYCFVTGMRLRSAITGIIYRKSLVITNSAKRSSTVGEVVNL
MSVDAQRFQDLTTFLNMLWSAPLQICLALYFLWQALGPSVLAGVAVMVLLIPINAFIAMK
TRAFQVEQMQYKDSRIKLMNEILNGIKVLKLYAWEPSFAQKVLEIRNKELNILKKAAYLN
ALSTFAWTSAPFLVALTTFAVYVTVDEKNILDAEKAFVSLSLFNILRFPLNMLPQVISNL
AQASVSIKRIQNFLANDELDLNAVTKDKTLPGNAITVHNGTFSWAKNGGAILQNINLLVP
SGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEVSVRGSVAYVPQQAWIQNCTLKDNILFG
RAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLSGGQKQRVSLARAVFSNADVY
LLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVLVDGRVTEM
GSYQELLKQNGAFSEFLRNYAFDDEVEEEDITIPDEEEVLLAEETLSTHTDLADNEPVAN
EARKKFIRQISILSDGEPSHAMSTRRRFTEKKPSENLVAKQPPTEKLIQTETTETGRVKM
TVFWQYMKAVGLAISVFICFLYSCQNAAAIGANVWLSDWTNEPVINQTQQNTQMRVGVYA
ALGILQGLLVMTSSFSLAIAGIGAARKLHSALLDNKMHTPQSFYDTTPIGRIINRFSKDI
YVIDEVIPGTILMFLATFFTSLSTMIVIVASTPLFAVVIIPLAIAYIFVQRFYVATSRQL
KRLESVSRSPIYSHFSETITGASIIRAYGRQNSFIVLSDNKVDENQKSYYPGIVSNRWLG
VRVEFVGNCVVLFAALFAVLGREHLSPGLVGLSVSYALQVTMSLNWMVRMTSDLETNIVA
VERVKEYAENETEAPWHIEDTKPPEDWPSKGEVELSNYSVRYRAGLDLVLKNLNLKVNGG
EKVGIVGRTGAGKSSMTLCLFRILEPAEGIVKIDNVNISEIGLQDLRSRLTIIPQDPVLF
SGTLRMNLDPFNKYSDDEIWKALELSNLKKFVAGQPSQLEYECSEGGENLSVGQRQLVCL
ARALLRKTRILILDEATAAIDLETDDLIQMTIRTQFEDCTVLTIAHRLNTIMDYTRVLVL
DKGRIAEFDTPTNLIALKGIFYGMAKDAGLA
NT seq 4596 nt NT seq  +upstreamnt  +downstreamnt
atggagacgttctgtgggtctggagatctggggtcccagttctgggattccaacctcacg
ttatatactgataatccggacgtaacgccatgttttcaaaatacggtgctggcatggatc
ccctgcgtgtacctgtgggtggcgctgcccttttatctcctgtatctgaagtacaaccgg
agaggctacattgtgctctccatgctgagcaaggccaagacggtgttcggagtgctgcta
tggtgcgtatgctgggccgacctcttctactccttccatggactcgtccagaaccagagc
ccgccccctgtctactttgtgacgccattgatactcggaatcaccatgatcacagctacg
gtgctcgctcagtatgaaaggctcaggggagtccagtcgtcgggggtgctaataatattt
tggttcctggcaacggtgtgcgccatcatccccttccgctccaaagttatggcctcagca
aggcagggccaagttactgataaattccgcttcacaacatttttcctttacttttctctg
ctggtaatagaactccttctgtcctgtttcaaagaagcgcgaccgttcttctcccccgtc
agagatgaaataaatccgtgcccagaatccgatgccggtttcctttcgagattaacattt
tggtggtttacaaaaatggctattttaggttacaaaaggccactggaagataaagatctc
tggtccctgaatgaagatgatacatcgaatgtggtggtgacaaatctcataaaggagtgg
gagaaggagaaaagcaacttggcgcagatgcaagtctcgtacagtaagaagccagaagca
gttctcaatcacacagacgagaaggcctacgaatctgacgttctaattgtagacaacaag
aaaccaaaggaaccgtctttcctgaaagttttgctcagaacctttgggccctacttttta
attggctccttttttaagctcttccaggacctcctctccttcgttaatcctcagctacta
agtattctgataacgtttataaagaacaaagatgctccttcgtggtggggattttgtatc
gccgtcctgatgttcctcacctccttggtccagaccttaatcctccaccagcatttccag
tactgctttgtaacgggcatgaggcttagaagcgccatcactggtataatatacagaaag
tcattggtaatcacaaactccgcaaaacgctcttcgactgtcggggaagtggtgaacctg
atgtcggtcgatgcgcagcgcttccaagatctgacaacgtttctcaacatgctgtggtct
gctccgttacagatatgcctcgctctctacttcctctggcaggccctgggaccgtccgtg
ctagccggcgtcgctgtgatggttttattgattcccatcaatgcctttatagccatgaaa
acaagagcgttccaagttgagcaaatgcagtataaagactcccgtatcaaactgatgaac
gaaatcctgaacggaattaaggttctaaaactctacgcctgggaaccgtcgtttgcgcag
aaagtccttgaaatacgaaacaaagagttaaatatcctgaagaaggcggcctatctcaac
gcgctgtcgactttcgcctggacgagtgccccgtttttggttgccctgaccacgtttgca
gtttacgtaacagttgatgagaaaaacatcctcgatgcagagaaagcctttgtatccctc
tctctatttaacattctgagattccccctgaatatgttgcctcaggtcatcagcaatttg
gcacaggcaagtgtttccattaaaagaattcagaatttcttggcgaacgatgaactagac
ctgaatgcagtgactaaagacaaaacgttaccaggtaatgctatcacagtacataatggg
acgttcagctgggctaagaacggtggagcaatactacaaaatattaacttgttggtccca
agtggctccctggtggcagttgtaggccaggttggctgtggaaaatcttctttggtgtcg
gcccttcttggtgaaatggaaaaagaagaaggggaggtgtctgtgcggggttccgtggcg
tacgttcctcaacaagcctggatacaaaactgcaccctaaaagacaatattctgtttggc
agagctgcgaatgaaaagaactacaagaaggttttggaagcctgtgcgttagtgacagat
ctggaagtcctacctggtggggaccagactgagattggagagaaggggattaatctgtca
ggagggcagaagcagcgagtgagccttgcccgggctgtgtttagcaatgccgacgtgtat
ctcttggacgaccctctctccgctgtggacgctcatgtggcaaaacacatctttgacaac
gtcataggacccgatgggttgctacgtggaaaaacaagagtgttagtcactcatggcatt
agtttcctgccccaagtcgaccatattgttgtattggtggatggaagagtcacagaaatg
ggatcttatcaagagcttttgaagcaaaatggagccttttctgaattcctgcgtaattat
gcttttgatgacgaagtagaagaggaagatataacaattccagatgaagaagaagtttta
ttggccgaggaaacattaagcactcacaccgatctggcagataatgagcccgttgccaat
gaagcccgcaagaagttcatcaggcagataagcatactatctgatggagaaccttcccat
gcaatgtcaacgaggagaaggtttactgaaaagaagccatcagagaacctagtggccaaa
caaccaccaacagagaagcttattcagacggaaactacagagacaggaagggtaaaaatg
acggtgttctggcagtatatgaaggcggttgggttggcaatctctgtctttatatgtttc
ctgtactcctgtcaaaatgcagcggccataggtgcaaatgtgtggcttagtgactggacc
aatgaaccagtaataaatcaaacccagcagaacacacaaatgcgagtgggagtgtacgcc
gctctgggcatcctacagggtctactggtcatgacatcttctttctctctggccattgct
ggaataggagcagcacggaaactccattctgccctcctcgacaacaaaatgcacacgccc
cagtctttctatgacacaacgcctatcgggcgcatcatcaaccgcttttccaaagatatc
tatgtgattgatgaagtgatacccggaacaatcttaatgttcctggcaacatttttcaca
tcgctgtccacaatgattgtaattgtagcgagcacacccctctttgcagtggtgatcatc
cctctcgccattgcatatatatttgtgcagaggttttacgttgcaacatcccgccagttg
aagcgcctcgagtccgtcagccgatcccctatatattctcatttctccgagaccatcacg
ggagccagcattatccgggcctacgggaggcaaaacagcttcattgtgctaagtgataac
aaagttgacgagaaccaaaaaagttattacccgggcatcgtatcaaacaggtggctgggt
gttagagtggagtttgttggcaactgcgtggtcctgtttgctgctctgtttgcagtcctt
ggcagggagcacctaagccctgggctggtagggctgtcagtgtcctatgcattacaggta
acaatgtccctaaactggatggtgaggatgacttcagatctggagaccaacatcgtagct
gtggagagagtaaaggaatatgcagagaatgagacagaggcgccctggcacatagaagat
acgaaaccaccagaggactggcctagcaaaggggaagttgaactgtcaaactattcggtc
cggtacagagctggtttggatctggtgctgaagaacctaaatcttaaagtaaacggagga
gaaaaggtgggaattgttggcagaaccggagcggggaaatcttcaatgacactttgcttg
ttccggattttggaacctgcagaaggaatcgttaaaatagacaacgtgaatatatcggag
attggtctccaggatctccggtccaggcttactataattcctcaggaccctgtactcttt
tctggaactttaagaatgaaccttgatccatttaacaagtacagcgatgatgagatctgg
aaggcgctggagctatcgaacctgaagaaatttgttgctggccaaccttcccagctggag
tatgaatgctctgaaggtggagaaaatctgagtgtcggacagagacaactcgtgtgtttg
gcaagggcccttctgcgcaaaaccagaattctcatcctagatgaggccacggccgctatc
gacttggaaacggacgatctcatacaaatgaccattaggactcagtttgaagactgcacg
gtgctaactatcgcccatcgcctcaacaccatcatggattataccagggttctcgttcta
gacaaagggagaatcgcggaattcgatactccgaccaatctcatagcactgaagggaatt
ttctacggaatggcaaaggatgccgggttagcctaa

DBGET integrated database retrieval system