KEGG   Xenopus tropicalis (western clawed frog): 100151722
Entry
100151722         CDS       T01011                                 

Symbol
ncam2
Name
(RefSeq) neural cell adhesion molecule 2 precursor
  KO
K06491  neural cell adhesion molecule
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100151722 (ncam2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    100151722 (ncam2)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:xtr04515]
    100151722 (ncam2)
   04090 CD molecules [BR:xtr04090]
    100151722 (ncam2)
   00536 Glycosaminoglycan binding proteins [BR:xtr00536]
    100151722 (ncam2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:xtr00537]
    100151722 (ncam2)
Membrane trafficking [BR:xtr04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    100151722 (ncam2)
Cell adhesion molecules [BR:xtr04515]
 Immunoglobulin superfamily
  NCAM1/2
   100151722 (ncam2)
CD molecules [BR:xtr04090]
 Proteins
  100151722 (ncam2)
Glycosaminoglycan binding proteins [BR:xtr00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   100151722 (ncam2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:xtr00537]
 Others
  100151722 (ncam2)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set Ig_4 Ig_6 C2-set_2 Ig_5 Ig_C17orf99 Receptor_2B4 Izumo-Ig Herpes_gE
Other DBs
NCBI-GeneID: 100151722
NCBI-ProteinID: NP_001120897
Xenbase: XB-GENE-1217730
UniProt: B2GU40
Position
2
AA seq 476 aa
MKVSYFYLLGLLVSSGQALMQVTISLSKVEISVGQSKYFTCTVIGEADNIDWFNPQGEKI
ISGQRVVVQREGIRSWLTIYKANVDDAGIYRCQATDSKGHAQEATVVLEIYQKLTFEDVP
SPQEFKRGENAEVLCLVSSSPAPMVRWLNNREDVTDIDDRRFAMLPNNNLQIKNISKRDE
GIYRCEGRVEVRGEIDFRDISVIVNVPPEILAQQRSFNATADRLEDITLFCRATGSPKPY
ITWHRNGKLVEENEKYDLREDNTELTVKNIISTDSGLYVCRATNKAGFTEKQSFLQVFVQ
PHIVQLQNETTIEHGHVTLTCEAEGEPIPEITWKRSSDGMIFYDGDKSQDGRIESTGHHG
KSSLHIKSVMLSDAGRYDCEAASRIGGHQKSMYLNIEYAPKFISNQTIYYSWENNPINIS
CDVTSNPPSSIYWSRDKLLLPARNITNIKTYRDGKRILLEITPLSDNDFGRYNSQL
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgaaagtctcctatttctacctgcttggattactggtcagcagcgggcaagctctcatg
caagtgacaatatcccttagcaaagttgaaatcagtgtgggtcagtctaaatacttcaca
tgtacagttattggagaagcagacaacatagactggtttaacccacaaggagaaaaaatc
atttctggccagagagtagtggttcaaagagaaggcatcagatcttggttgaccatatat
aaagcaaatgttgatgatgcgggtatctatcgttgccaagctacagattctaaaggacat
gctcaggaggctacagttgttttggaaatttatcaaaaactgacatttgaggatgtgccg
tcacctcaagaattcaaaagaggagaaaatgcagaagttttgtgtctcgtcagcagctca
cctgctccaatggttagatggttaaataaccgtgaagatgtcacagacattgatgacagg
cgctttgcaatgttacccaacaacaatctgcagattaaaaacattagtaaaagagatgaa
ggcatttatagatgtgagggtcgggtggaggttagaggtgaaattgatttccgggatatc
agtgtcattgtaaacgttcctccagagattttagctcagcaaagatcttttaatgcaaca
gcagatcgactggaggatattactttattttgccgggccacgggttctccaaagccttac
atcacctggcacaggaatggcaagctggttgaggaaaatgaaaagtatgatttaagagaa
gacaatacagaactcactgtcaaaaacattataagtactgattccggactgtatgtatgt
agagcaacaaataaagcaggatttacagaaaaacagtcttttctacaagtgtttgtgcag
cctcatattgtacagctacaaaatgaaactacaatcgagcacggacacgtaactcttaca
tgcgaagctgaaggagaacctattcctgaaattacctggaaaagatccagtgatggaatg
attttctacgacggtgacaagagccaagatggacgtatagaaagcacaggacatcatgga
aaatcctccttacatattaaatctgtgatgttgtctgatgcagggagatatgactgtgaa
gcagcaagcagaattggtggccatcaaaaaagcatgtatttaaatattgaatatgcaccg
aagttcatatcaaatcaaaccatttactattcttgggaaaataaccctataaacataagt
tgtgatgtgacgtccaatccgccatcatcaatttactggagcagagacaaattattgttg
cctgcacgaaatataacaaacataaaaacttatagagatggaaaaagaatattgctagag
ataacaccattatcagacaatgattttgggcgttacaactcacagctataa

DBGET integrated database retrieval system