KEGG   Xenopus tropicalis (western clawed frog): 100170154
Entry
100170154         CDS       T01011                                 

Gene name
dicer1
Definition
(RefSeq) endoribonuclease Dicer
  KO
K11592  endoribonuclease Dicer [EC:3.1.26.-]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xtr03036]
    100170154 (dicer1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     100170154 (dicer1)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    100170154 (dicer1)
   microRNA pathway
    RISC loading complex
     100170154 (dicer1)
SSDB
Motif
Pfam: Ribonuclease_3 PAZ Dicer_dimer Ribonucleas_3_3 Helicase_C DEAD ResIII dsrm DUF2075
Other DBs
NCBI-GeneID: 100170154
NCBI-ProteinID: NP_001123390
Xenbase: XB-GENE-491114
UniProt: B3DLA6
Position
8
AA seq 1893 aa
MAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNSGSGK
TFIAVLLSKELSYQIRGDFSKNTKRTVFLVNSEKQVSQQVSAVRTHTDLKVGEYSDQEKT
QCWAKERWYLEFETHQVLVMTCHIFLNVLKSGNVSLSNINLLVFDECHLAIQDHPYREIM
KICESCQPCPRILGLTASILNGKCDPRDLEEKIQKLEEILRSNAETATDLVVLDRYASQP
CEIVLDCGPYIDKSGLYQRLLNELDEALNFLIDCNISTHSKERDSTLISKQILSDCQTVL
LVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTILRKIHALCEEHFSPASLDM
KFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDDEDEEIEEKEK
TETSFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQP
RNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPSEYRSYVQS
KGRARAPISNYIMLADSDKIKAFEEDLKTYKAIEKILRNKCSKSIDCGNTESEPIVDDDE
IFPPYVLRQDDGSPRVTINTAIGHINRYCARLPSDPFTHLAPKCKTREFPDGLYRSTLYL
PINSPLRAPIVGPPMNCGRLADRAVALICCKKLHEIGELDDHLMPVGKETVKYEEELDLH
DEEETSVPGRPGSTKRRQCYPKAIPECLRNSYPKPGQPCYLYVIGMVLTTPLPDELNFRR
RKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFTLNLEQLELITRL
HQYIFSHILRLEKPALEFKPTVADCAYCVLPLNVVNDSGTLDIDFKFVEDIEKSEARTGI
PNTQYSAESPFIFKLEDYQDAVIIPRQVIYRNFDQPHRFYVADVYTDLTPLSKFPSPEYE
TFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWES
LQNKQILVPELCAIHPVPASLWRKAVCLPSILYRLHCLLTAEELRAQTAIDAGVGVKSLP
DDFRYPNLDFGWKRSIDSKTFISNQSSSSVESESDCRLNKTTAPDSAASSAANSVIYMQI
NDQMSVNCTPPCQKSLSHLQTVCFSDDYKAINGISCNGLTNGDWEAESAACFQKDERITC
KQEIPEKSTSFHVQNLPKENQPILKECTLSNSDGNVSKPTSDECPSTCTSDMHYDSGLSN
RHSSKTLGPNPGLILQALTLSNASDGFNLERLEMLGDSFLKHAITTYLFCTYPDAHEGRL
SYMRSKKVSNCNLYRLGKKKGSPSRMVVSIFDPPVNWLPPGYIVNQDKNSDKWESNETSG
EDVMVNGKIDEDFDDEEDEDLMWRNPKEETDFDDDFLEYDQEHIKFIDSMLMGSGAFVKK
IPLSSFAPPDQNYEWRAPKKPPLESSQFPCDFDDFDYSSWDAMCYLDPSKAVEEDDFVVG
FWNPSEENCGADAGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSL
GLKVLPEVRKLVTNTNVISASSSYQNSTRDNCTLTARTNTDLSSCKGIDYGYLKIPPRCM
FEHPDAEKTLDHLISGFENFEKKINYPFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGD
AILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAISPELFHVI
DDFVQFQLEKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLET
VWHVYYPMMQPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGK
FKGVGRSYRIAKSAAARRALRSLKANQSQVPNS
NT seq 5682 nt   +upstreamnt  +downstreamnt
atggcaggccttcagctcatgactccggcctcctctccaatgggtcccttctttgggcta
ccctggcaacaggaggctattcatgacaacatttataccccacggaaatatcaggtggaa
ctactcgaagcagcattggatcataatactatagtatgtttgaattctggctcagggaag
acatttattgcagtactactcagtaaagagctgtcataccagatccgtggggacttcagc
aaaaatactaagaggactgtgtttttggtcaattccgagaaacaggtttctcaacaagtg
tctgctgtcaggacccatacagacctcaaggtgggagaatattcagatcaagaaaaaaca
caatgctgggcaaaagaaagatggtacctagaatttgaaactcatcaggtcttggtcatg
acctgccacatcttcctgaacgttctgaaaagtgggaacgtgtcattgtcaaacattaat
ctgttagtgtttgatgaatgtcatcttgcaattcaggatcacccatatcgagaaatcatg
aagatatgtgagagttgccagccatgccctcgaatcctgggtctaactgcttcaatttta
aatggaaaatgtgaccctcgtgacctagaggaaaagatccagaaactggaggaaatatta
aggagtaatgcagaaactgcaactgatttggttgttttagacaggtatgcttcccaacca
tgtgaaattgtattggactgtgggccatatattgacaaaagtggactttatcaaagactt
ctaaatgaattggatgaagcccttaactttctcattgactgtaatatttctacacattct
aaagagagagattccacattaatttcaaaacagattctatcagactgtcaaactgttctt
ttggtcttgggaccatggtgtgctgataaagttgcggggatgatggtgagagagctgcag
aagtatatcaaacatgagcaggaggaactgcacagaaaattccttttgtttacagacact
atcttaaggaagatccatgctctttgtgaggaacacttctcgccagcctctcttgatatg
aagtttgtcacacctaaagttataaaactgctggaaattttacgcaaatacaaaccctac
gaacgccagcaatttgaaagtgttgaatggtataacaatagaaaccaggataattatgtg
tcttggagtgattcagaggatgatgacgatgaagatgaagaaattgaggagaaagagaaa
actgaaacaagctttccatccccattcacaaacatcctgtgtggcatcatcttcgtggaa
cgaagatacacagcagtagtattaaacaggttgattaaagaagccgggaagcaagatcca
gagctggcctatatcagtagtaactttattactgggcacggcataggaaagaaccagcca
cgcaataagcagatggaagttgagtttagaaagcaagaagaggtgcttcgtaaatttcgt
gcacacgaaaccaacttattgatagctactagcattgttgaggaaggagtggacatacca
aaatgcaacttggtagttcgatttgatttaccttcagagtacagatcctatgtacagtcc
aaaggcagagcaagagcaccaatctcaaattacatcatgctagccgatagtgataaaatt
aaggcatttgaagaggaccttaaaacatacaaagcaattgaaaagattctgcggaacaaa
tgctcaaagtccattgattgtggaaatacagaatctgagcccattgtggacgatgatgaa
atatttccaccatatgtgttgagacaggatgatggcagcccacgagttactatcaacacc
gctattggacacattaacaggtactgtgctaggctacctagtgacccatttactcatctt
gctcctaagtgcaaaacacgagagttccctgatggactttatcgctcaacactctacctg
ccaattaattctccacttagagcccccattgttggccctccgatgaattgtggaaggcta
gctgatagagctgtagctcttatatgctgtaaaaaactacatgaaattggtgaactggat
gatcatttaatgccagttggcaaggaaactgtaaaatatgaggaggagcttgatttgcat
gatgaggaagaaaccagtgttccaggcagaccaggatccacaaaaagaaggcagtgttat
ccaaaagctattcctgaatgtttacggaacagctaccccaagcctggtcagccttgttac
ttatatgtaataggaatggtattaaccactcctctaccagatgaacttaattttaggcga
cggaagctgtatccccctgaagacacaacaagatgctttggaatactaactgccaaaccc
atacctcagattcctcactttcctgtctatactcgttcgggagaggtgaccatatcaatt
gaactaaagaagtctggttttacattaaacttagaacaacttgagctcattactagactc
caccagtacattttttcacacattcttcgtcttgagaaacctgcactagaatttaaaccc
acagtagccgattgtgcctactgtgttctacctcttaacgttgtaaatgattctggcact
ttggacattgacttcaaatttgtagaagatattgagaaatcagaagcacgtactggtata
cctaatacacagtattcagctgaaagtccttttattttcaaattagaagactaccaggat
gctgttatcattccaaggcaagtaatatatcgaaattttgatcagccgcacagattttat
gtagctgatgtatacactgatcttacaccgctcagcaagttcccttcccctgaatatgaa
acctttgctgaatattacaaaacaaagtataacctcgatctcacaaacctcaatcagcca
cttttggatgtggaccacacatcatcaagacttaatttgctgactcctcgccatctgaat
cagaaaggtaaagctctgccattaagcagtgctgaaaagagaaaagccaaatgggagagt
ttacaaaacaaacagatcctggttccagagctttgtgctatacatccagtcccagcatcc
ttatggagaaaagctgtttgtttgccaagcatactttatcgattacattgcctccttaca
gcagaagagctgagagcgcaaacagctattgatgctggggtaggagtcaaatcgcttcct
gatgatttccgatacccaaacttggattttggatggaaacgatctatagacagtaaaaca
ttcatctctaatcaaagttcctcatcagtcgagagtgaaagtgactgcagactcaataaa
accacggcccctgacagtgctgcaagctcagctgctaattctgtaatctacatgcaaatc
aatgaccaaatgtctgtgaactgcacaccaccatgtcaaaaatctctgagtcacctccaa
acagtttgcttctcagatgattacaaagcaattaacggtatttcttgcaatggtcttacc
aatggtgattgggaagcagaaagcgctgcatgtttccaaaaggacgaacggataacctgc
aaacaggaaatacctgaaaaatctacctcgtttcacgttcagaatttacctaaggagaac
cagcccatacttaaagaatgtactctgagcaactctgatggaaatgtcagcaaacctacc
tcagatgagtgccctagcacctgtacttcagacatgcattatgatagtgggctttccaat
aggcactcttcaaaaactcttggcccaaaccctggtcttatccttcaggccttgactctg
tccaatgcaagtgatggtttcaatctggagcgtcttgaaatgcttggggactctttctta
aaacatgctatcaccacatatctgttctgcacatacccagatgctcacgagggccgtcta
tcctatatgcgcagcaagaaggtcagtaactgtaacctttatcggcttggaaaaaagaaa
ggctcacccagccggatggtggtgtccattttcgatccacctgtcaactggcttccccct
ggttatattgttaaccaggacaaaaactctgataagtgggaaagtaatgaaacgtctggt
gaggatgtgatggttaatggcaaaattgatgaagactttgatgatgaagaagatgaagat
cttatgtggaggaatcccaaagaggaaactgattttgatgatgactttttggaatatgat
caagagcatataaaattcattgacagcatgttaatgggatctggggcatttgtgaagaaa
attcctctttcttcatttgcaccccctgatcagaactatgaatggagggcgccaaagaaa
cctccactggaaagttctcaatttccctgcgattttgatgattttgattacagttcttgg
gatgccatgtgttatttggatcccagcaaggctgtagaggaggatgactttgtagtaggc
ttttggaatccatcagaagagaactgtggagctgatgctggaaagcagtctatatcttat
gacctacacacagagcagtgtattgcagacaaaagtatagctgactgtgtagaggcttta
ttaggctgctatctgaccagttgtggtgagagagctgcacaactgtttctttgttctttg
ggcttaaaagtgctcccagaagtaagaaagcttgttacaaacacaaatgtcattagtgca
tcatcatcttaccagaacagtaccagagacaactgcactcttactgccagaaccaacact
gatctgtcctcctgcaaaggcatagactacggttatttaaagattcccccaaggtgtatg
tttgagcacccagatgctgagaaaacccttgaccatctaatatctggttttgaaaacttt
gagaagaaaataaactatccatttaaaaacaaggcttaccttctacaggcttttacacat
gcctcttaccactacaatactataactgactgctaccagcgtttagaatttcttggagat
gcaattttggactacctcattactaagcacctttatgaagatccacgccagcactcgcca
ggagtcctcactgacctgcgctctgctcttgtgaataacaccatatttgcatcactagct
gtgaaatatgactaccataaatacttcaaggctatctctcctgaactgttccatgtaatt
gatgattttgtgcaatttcaacttgaaaaaaatgaaatgcaaggcatggattctgagtta
cgtaggtctgaagaagacgaagagaaagaagaggacattgaagtcccaaaagctatggga
gacatatttgagtcacttgcaggagctatttacatggacagcggcatgtctttggaaact
gtatggcatgtgtattatcctatgatgcagccattaatagaaaaattctctgctaatgtt
cctcgttccccagtgagagaattactggaaatggagcctgaaactgctaaattcagtcca
gccgaaagaacatacgatggaaaagtcagagtgactgtggaagttgttggaaaaggaaaa
tttaaaggagtcggaagaagttacagaattgccaaatctgcagcagccaggagagcacta
agaagcctcaaagcaaatcaatctcaggtccctaacagctga

DBGET integrated database retrieval system