KEGG   Xenopus tropicalis (western clawed frog): 100485488
Entry
100485488         CDS       T01011                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xtr03000]
    100485488 (ahrr)
Transcription factors [BR:xtr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100485488 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 100485488
NCBI-ProteinID: XP_017950411
UniProt: A0A5G3JY16
Position
6
AA seq 753 aa
MIPPGECMYAGRKRRKPVQKQRPSSGSEKSNPSKRHRDRLNAELDRLASLLPFPPEIIAK
LDKLSILRLSVSYLRVKSFFQAIEEQHSKKQPSQPVGHAIKEDKTSSGTAMPEGELLLES
LNGFALVVSTEGMIFYASATILDYLGFHQTDVMHQNIYDYIHVDDRQEFSRQLHWAMNPQ
QMVLTQESHTDTGEDAFLNKLFEAEESDSSPSAYSSFLNRCFICRVRCLLDSTSGFLTMQ
FEGKLKFLFGQTKKASSGAIHPPQMALFCVAVPLLLPPVNEIKIKSVLLRTQKKPSATSN
SENTAKPFPGTCEVEHAGRNSHQGTYFPNILHGPENQIKLMNSGDNGISLFKVRTNEDQW
LWVEANTPLRYRNGCSDYIVVPQQSEEEMKKHGGALGLKGTRETSLGVNDMPALLKHHLP
WGKQEKEDIKVKFQLNKCDPILQEETSFFQKQISTAQNSCSTSGTWVGKPSARINHQFIG
SFSDRINRPFYNMDQSPPGVHMLGRHHRGNTEHFQPYSGFQQHALDSYPVEHIKLENPFV
TPEVLYDSGLPLNIPIKTENDSDSEGQPELYSECQTHAWLTENNGLKKQLDFSESLHLKT
ELDFSEQTSCFKPKHYMHSSHRGHCYASGTHMNHFNAGRPFKGIYNKDAGQFCPPKCAYL
ESVLSLQAADCSNNQFYSVATVDDKNTGDHSYKLQCEFKAHSLVQNIKREPLDSPPWVES
QQEAVQSIYQKNTLMGFLPSQVPRNAAEFAYIQ
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgattccaccaggagaatgcatgtatgctggcaggaaaagaagaaaaccagtgcaaaaa
caaaggccttcgtcaggaagtgaaaaatcaaatccttcaaagagacatcgagatcgtttg
aatgctgagttagatcgtcttgccagtctccttccatttcctcctgaaattattgcaaaa
ctggataaattatctattcttcgtcttagtgtcagttatctcagagtaaaaagcttcttt
caagcaattgaagaacagcactccaagaagcaaccctcccagccagtcggtcacgcaata
aaagaagacaagacatccagtgggactgccatgccagaaggagagttgttattagaatcc
ctgaatggctttgcactggttgtgagtacagaaggcatgatattctatgcatctgcaaca
atattggactatctgggcttccatcagactgatgttatgcatcaaaatatatatgattat
attcacgttgatgatcgccaggaattcagcaggcaacttcattgggctatgaaccctcag
cagatggtgcttacacaggaatctcatacagacacaggtgaagatgcattcctcaacaaa
ctttttgaagcagaagagtcagattctagcccctcagcatattcatcatttctaaaccga
tgtttcatctgtcgtgtccgctgcttgttggatagcacttcagggtttctaacaatgcag
tttgagggcaaactgaagttcctctttggtcagacgaaaaaagcatcttcaggagcaatt
catccgccgcagatggcgttgttctgtgtagcagtgccacttctgcttccccctgtcaac
gagattaaaataaaaagcgtgctcttgaggacacagaaaaaacccagtgcaacttccaac
tcagaaaacacagcaaaacctttcccaggtacatgtgaagtagagcatgctggaagaaac
agtcaccaggggacctacttccctaacattttacatggtccagaaaatcagatcaaatta
atgaattctggtgataatggaatttcattgttcaaagttcgaacaaatgaagaccagtgg
ctatgggtagaggcaaacacaccactacgatacagaaatgggtgctcagactatattgtg
gttcctcaacaaagtgaagaagagatgaagaaacacggtggtgctcttggtttaaaagga
actagagaaacatcactaggtgtcaatgatatgccagctctcctgaaacatcatctccct
tggggtaagcaggagaaagaagatataaaagtcaagtttcagctaaacaaatgtgaccct
attttacaggaagaaaccagttttttccagaaacaaatttccactgcacaaaatagctgc
agcacaagtggtacatgggtagggaaaccatctgccaggataaatcaccagtttattgga
tcattttcagataggataaacagacctttctataatatggaccagagtcctcctggagtt
cacatgcttggccgtcaccaccgtggcaacacagaacacttccagccatactctggtttt
cagcagcacgccttagactcctatcctgtagaacatatcaaactggaaaatccttttgta
actccagaggtactttatgattcagggttacctttgaacatcccaatcaaaacagaaaat
gactctgattctgagggccaaccggagctatattctgagtgccaaacccatgcttggcta
actgagaacaatggactgaaaaaacaattagacttttctgaaagtcttcatcttaaaact
gaattggatttcagtgaacaaacttcttgtttcaaaccaaagcattatatgcactcctct
cacagaggccactgctatgcatcaggaacgcatatgaaccatttcaatgcaggaagacca
tttaaaggaatttataacaaagacgcaggccagttctgccctccaaaatgtgcgtattta
gaaagtgtgttaagccttcaagctgcagattgttcaaacaaccagttttattcagtggcg
acagtagatgacaagaatactggtgaccactcttataagcttcagtgtgaattcaaagct
cacagccttgttcaaaatatcaagagagagcctcttgattcacctccatgggttgagagc
caacaggaagcggtacaatctatctaccaaaaaaacacattgatggggttcttgcccagc
caagtgccacgcaatgctgcagagtttgcctacattcaataa

DBGET integrated database retrieval system