KEGG   Xenopus tropicalis (western clawed frog): 100485801
Entry
100485801         CDS       T01011                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xtr01002]
    100485801 (adamts13)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     100485801 (adamts13)
Peptidases and inhibitors [BR:xtr01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   100485801 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 Reprolysin ADAM_CR_2 ADAM_spacer1 Reprolysin_4 Reprolysin_3 TSP1_spondin Reprolysin_5 Reprolysin_2 Pep_M12B_propep TSP1_CCN Peptidase_M10 Peptidase_M66
Other DBs
NCBI-GeneID: 100485801
NCBI-ProteinID: XP_031747422
Xenbase: XB-GENE-6038835
Position
8
AA seq 1593 aa
MTRPVRLWVALGLLLSPVLCATKKFLHHLEPEELYGYFGATSVLESNVVDLAELTCSCES
PELPPLCLALRCILQGTEGTFVFRFPVGSGPIITERVVNTSLQRLKHFPEGCGVPGFILY
PDETKAVISYCEGELRGFIVSDGHLLSIQPLKKRHEQDHKSRSSHIISRVGKSPPASGGP
RPAPLPNRISKRAVGGVKHLELLVVVGHDVYQFHQEDTERYVLTNLNIGVELLRDVSLGT
AFRVHLVKLIILTEPEADIQITTNLTSSLISLCKWSHKVNPPDDSDPQHADLVLYVTRFD
LELPDGNKQVRGVTQLGGACSSVWSCVITEDTGFDLGVTMAHEIGHSFGINHDGTGNSCS
KSGNIMASEGYHNNVHLTWSECSREQFLRFLSSGMASCVDDLPAMDSSIPGWKPGLYYGA
DEQCQIAFGSSALACTFSRNDLDSCSVLSCHINQHDRTSCNRLLVPLLDGTECGENKWCH
KGRCSSLEELNPVSVVHGGWSSWGSFSSCSRSCGGGVVMRKRQCNNPRPAFGGRACEGSN
LQAEMCNTQVCSSTQIGFMNEQCSDTDTKPLYLSPGIPSFYKWTSAVGFVDGKALCQYMC
RAQGKSFIVARGKSFLDGTRCETNKEANAKLGLCVAGSCRVFGCDGVMGSGMVKDQCGVC
GGDNSTCNRIHGSFSEGKAGEYVSFLTLPPGSTSLKVTNQKPVFTHLGIKVNDEYLVAGK
GSISLNVTYPSVLEDQTIEYRLFLNADKLPHLEQIHIEGPTTKELEIQVYRKYGQEYGDA
TNPDIIYSYHIPKKDIEYKWFPVPGPCSASCDGGFHLVSYECSEHDLNQLVQSSLCNDSA
RPSSFHEPCGIDPCPPRWDVKESSPCTVSCGGGVVLRTLHCVQMQQGIETILFDAYCDHS
TRPEAFVACGLEPCPARWEASEAGLCPVVCGSGLALRNVSCVQSHAGLEVAVEESNCLGQ
EKPTTQVECVVSVCPVGWDMQMDSSLRLSERSSREETAEKHTEVYVWSPRVGPCSVSCGT
GISELSYICVDFYTKTETAEENCNQTLKPEPRPNVCNLGTCPPLWEVKELGPCPVTCGGA
TIPLAVICVRRDGNISYSLPHSKCSRIPRPRASKPCGMEPCPVRWRYKTGSCSVSCGGGI
LQRVLYCSRYPQKGESEEQIVSDLECQHLPHPEGQEPCNQQLCPPRWKVAEATPCSAACG
YGISKQRVVCVQTVEGAEKEMDLDSCVLQEKPPSLIPCIVNNCFYSWEVSAWTQCSVTCG
NGIQSRQDVCTNLKTRQPVSPTFCGNAPKPITIRGCSAQTCRPETTTPQAALASTALVTQ
LPPSDAILRPQWRSAVTPREHNLEYNRRREPGKAEEEDGSTSICGQLFLNATGVLSTTGL
NERDCMFTIGRPLGEVIIVRVLSSTLNCTAGELLLFFGRVMWRKTCARLSGVTLLSRSNT
LSVRQRQAIDGNGVVLEYWSKPAAQNYSQACDIQLYGMGGEIRNPVQPWMEGGSPACRVF
IDVAPQYYIAIHALYMDLEPMSNHTHPSSILIRDMKSLKSTGFHGNHLFYWESAGSRAEI
EFHGDFSKDRVSFRAQYWARAPRLQGRGRPPVE
NT seq 4782 nt   +upstreamnt  +downstreamnt
atgacccggccggtccgtctgtgggtagcccttggcttgctcctttctcctgtactgtgt
gcgacaaagaagttcttgcaccatctagaacctgaagaactatatggatacttcggtgca
acatctgtcctagaatccaatgtggtggacctggctgagctgacctgctcctgtgagtcc
cctgagttgccacccctatgtttagctttgcgttgcatccttcaggggacagaggggaca
tttgtcttcaggttccctgttggttccggacccatcattacggaacgtgttgtcaacaca
tctctgcaaaggctcaaacatttcccagagggctgcggggttccgggtttcattctatat
ccagacgaaaccaaagcagtgatcagctactgtgaaggagaacttcgtggattcatcgtc
tctgatggacacttgctctccatacaaccgttgaagaagaggcatgagcaagaccacaaa
tcccgaagttctcatattatctccagagtagggaaatcaccccctgccagtggtggacca
aggcctgcccctttgcccaaccgaattagcaaacgagcagttggtggtgtgaagcatttg
gagctcctagtggtagtgggtcatgacgtctaccagttccaccaagaggacactgagcga
tacgtcctgaccaaccttaacattggggttgagttgctgagagatgtctcacttggaacc
gcattccgtgtccatcttgtgaagctaattatcctgaccgaaccggaggcagatatccaa
attaccaccaacctcacctcctcgttgatcagcctttgcaaatggagccacaaggtgaac
cctccagatgactccgaccctcaacatgcagaccttgttctctatgtgaccagatttgat
cttgaattaccagatggcaacaaacaggtgcgaggagtcacccagctgggcggggcctgc
tcgtctgtttggagttgcgtcattactgaggacaccggctttgatctgggagtcaccatg
gcacatgagattggacacagttttggaatcaaccacgacggaacggggaacagctgcagc
aaaagtgggaacatcatggcatcggaggggtaccacaataacgtccacctcacctggtct
gaatgcagccgggaacagttcctcagattcctcagcagcggcatggcaagctgtgttgat
gacttgccagcaatggacagtagtattcccggctggaagcccggtctgtattatggagca
gatgagcagtgtcagattgccttcggcagctctgccctggcatgcactttctccagaaat
gacctggattcctgcagtgtcctctcatgccacataaaccaacacgatcgtacgagttgc
aacagacttctggtcccccttctagatggcacagagtgtggggagaacaagtggtgccac
aagggccgttgcagttcactcgaagagctgaatccggtttccgtagtgcacggaggatgg
tccagttgggggtctttctcctcatgttcccgcagctgtggtgggggagtcgtgatgagg
aaaaggcagtgtaacaaccctagacctgcatttggtggacgcgcctgtgagggatccaat
ctacaggctgaaatgtgtaacactcaggtctgtagcagcacccagatcggtttcatgaat
gagcaatgttctgatacagacaccaaacctctctatctcagcccaggaattccaagtttt
tacaagtggacctcagccgttggctttgtcgatgggaaagcgctgtgtcaatacatgtgt
cgagcccaggggaagagtttcatcgtagcacgagggaagagttttttggatgggacccgg
tgtgagacaaataaggaggccaatgctaagttgggtctctgtgtagctggcagttgcagg
gtctttggctgtgatggagtgatgggatctgggatggtgaaggatcaatgtggtgtgtgt
ggaggagataacagcacgtgcaatagaatccatggctctttctctgaagggaaagccgga
gagtatgtctccttcttgactcttccaccaggctccacatctttaaaagtgacaaatcaa
aagcccgtttttacgcatttggggattaaggtgaacgatgagtacttggtagcgggaaag
ggaagtatttctctcaatgtaacctacccatcagtcctagaggaccagacaatagaatac
cggttgtttctgaatgcagacaagcttccacatctggagcaaatccatatagagggtccc
accacaaaagaacttgagatacaggtttacaggaaatatggccaggaatatggagatgct
acaaaccccgacatcatttatagttaccatatacccaagaaggacatagaatataaatgg
ttccctgtgccaggaccctgttcagcaagctgtgatgggggttttcacttggtgtcttac
gaatgttccgaacatgatctgaaccagttggtccaatccagcctctgcaatgattctgca
cgcccgtcttcattccatgaaccatgtggcatagatccatgtcctcctaggtgggatgtg
aaggaaagttccccatgcacagtgtcctgtggtggtggggtggttctaagaactctacat
tgtgttcaaatgcaacaaggcattgagaccattctatttgatgcctactgcgaccactca
acccgtccagaagcctttgttgcctgtggcttagaaccctgtcctgccagatgggaagcg
tcggaggctggtctctgcccggtggtgtgtggctcaggtctggctttgagaaatgtctcc
tgtgttcagtctcatgctggattggaagttgcggtggaagaatcaaactgtttaggtcaa
gaaaagccaacgactcaggtggaatgcgtagtcagtgtgtgtcctgtcggctgggacatg
cagatggactcttcattgaggttgagtgaacgttcctctcgtgaagaaactgctgagaaa
catacagaagtctacgtgtggagcccacgggtcggaccatgctcagtgagctgtggaaca
ggaatatctgagcttagctacatctgtgtggatttctacaccaagactgaaaccgcggag
gagaactgcaaccaaactctgaagccagaaccacggccaaacgtctgcaaccttggaacg
tgcccaccgctgtgggaagtgaaggagctcggtccatgtcccgtgacctgtggaggagca
acgattccactcgctgtgatctgtgttaggagagatggaaatatctcctattcccttcct
cactccaagtgcagccgaatccctcgtccccgtgccagcaaaccttgtgggatggaaccc
tgcccagtccggtggcgctataaaacaggatcttgcagtgtgagctgcggcgggggcatc
ttgcagagagtcctctactgctccaggtatccccaaaaaggagagagtgaggagcagatt
gtatccgatctagaatgccaacacttgcctcatccagaaggacaggaaccctgcaaccag
cagctttgcccacccaggtggaaggtagcagaggcaactccatgctcagcagcctgtgga
tatggcatctccaagcagagagtagtgtgtgtgcagacagtagaaggggcagagaaggag
atggacctggactcttgtgtccttcaagagaagccaccatctctcatcccttgcattgtc
aataactgcttctactcatgggaagtcagcgcctggactcagtgctcggtcacctgtggg
aacggtatccaaagccgtcaagatgtttgcaccaacctaaaaacccgacagccggtgagc
cccaccttctgtgggaatgcccccaaacccatcactattcgcggatgctcagcccagaca
tgtaggcctgaaacgaccactccgcaggctgccttggcaagtacagctctggtcacccag
ctgccgcccagcgacgccatcttgaggccacagtggagatctgctgtaacccctcgggaa
cacaaccttgagtacaatcgacgtagagaaccaggcaaagctgaggaagaagatggtagt
accagtatctgcgggcagctgttcctcaacgctacaggagtgctgagtaccacggggctc
aatgagagagactgtatgttcaccattgggcgccccctgggggaggtgattatagtccga
gtgttgtccagcactctcaactgcacagccggggagctgctgctgttcttcgggcgggtc
atgtggcgcaagacgtgcgctcgcctctcgggggtgaccctgctgtctcggtcgaacact
ctctctgtgagacagcgccaggctatagacggcaatggggtggtactggagtactggagc
aaaccggccgcccaaaactactcccaagcatgcgatatccagctttatggaatgggggga
gaaatccggaatcccgtgcagccctggatggaggggggatccccagcttgtagagtcttc
attgacgtggccccccagtattacattgctattcatgctttgtacatggacctggaaccc
atgagcaaccatacgcacccaagttctattctgattcgggacatgaaatcgctcaaatcc
acgggattccatgggaaccacttgttctactgggagtcggcggggagtcgggcggaaata
gaatttcatggcgatttctctaaggaccgagtcagtttccgggcgcagtactgggcgcgg
gcaccgaggctacagggcagggggcgccccccggtggaatga

DBGET integrated database retrieval system