KEGG   Xenopus tropicalis (western clawed frog): 100489468
Entry
100489468         CDS       T01011                                 

Symbol
krt62
Name
(RefSeq) keratin, type II cytoskeletal-like
  KO
K07605  type II keratin, basic
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:xtr04812]
    100489468 (krt62)
   04147 Exosome [BR:xtr04147]
    100489468 (krt62)
Cytoskeleton proteins [BR:xtr04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     100489468 (krt62)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100489468 (krt62)
  Exosomal proteins of other body fluids (saliva and urine)
   100489468 (krt62)
  Exosomal proteins of colorectal cancer cells
   100489468 (krt62)
  Exosomal proteins of bladder cancer cells
   100489468 (krt62)
SSDB
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 DUF4618 ATG17_like DUF1664 Baculo_PEP_C ADIP TSNAXIP1_N COG5 CENP-F_leu_zip Crescentin DUF4407 Cob_adeno_trans BicD Taxilin DUF5667 AAA_13
Other DBs
NCBI-GeneID: 100489468
NCBI-ProteinID: XP_002935776
Xenbase: XB-GENE-920459
UniProt: A0A6I8QYX0
Position
2
AA seq 570 aa
MSHYKQFSVRSVATSGKPGFSSFSVSKSGGGFGGSSGGGSFGSRSLYSVGSRKVSSVGSA
SGGGFGFAAGGFGGRGFGGGVGGGAFGGAGGGAFGGAGGGAFGGAGGGGFGGAGFGGFGG
AGFPGGPSVGIQEVTVNQSLLAPLNLEIDPTIQKVRLEEREQIKTLNNKFASFIDKVRFL
EQQNKVLETKWSLLQEQGGQVKGSRKNNIDPIFDAYINSLKRQLDALQNDKLRLDGELRN
MQDLVDDFKNKYEDEINKRTSAENEFVVIKKDVDAAYMGKVELEAKVDALTDELNFLRTF
FEAELGELQAQISDTSVVLSMDNNRALDLESIIAEVKSQYEDIAKKSRAEAESVYQGKVQ
ELQASAGEQGDVLRNTKSEISELNRKSQRLKAEIENVKKQIAKLQASITEAEERGDLVLK
DAQSKLAELEAALQKVKQDMARQLREYQELMNVKLALDVEIATYRKLLEGEEFRLNSDVN
NVSISVISSGGKSSLGGGGGGSGAGFGFGSGGAAFGGSGGAAFGGSGGAAFGGSGVSFGS
GGGGFSSSSSSFGGGVGSVRYSSSQSSYRS
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgagtcattataagcagtttagtgttcgatctgttgcaacctcaggcaagccgggcttc
agctcattttctgtgtctaaaagtggtggaggttttggaggttcttcaggagggggtagc
tttggtagcagaagtctttacagtgtggggtctaggaaagtcagttccgttggctctgca
agtggaggtggctttggatttgcagcaggtggttttggtggaagaggttttggtggtgga
gtaggtggaggagcttttggaggggctggcggtggtgccttcggaggagctggcggtggt
gcctttggaggagctggcggtggtggctttggaggagctggatttggaggctttggaggt
gctggctttcctggtggaccatcagttggtattcaagaagtcacagtcaaccaaagtctc
ttggcaccactgaacctggaaattgatccaactatacagaaagttcgactggaggagaga
gaacaaattaaaactctgaacaacaaatttgcttcctttattgacaaggtccggttcctt
gaacaacagaataaggtacttgaaactaaatggagcttattgcaagagcaaggaggccaa
gtaaaggggtcaagaaaaaacaacattgaccctatttttgacgcctatatcaacagcctc
aagaggcaactggatgctctgcaaaatgataaactacggcttgatggggagttaaggaat
atgcaagacttggttgatgattttaaaaacaaatacgaagatgaaattaataagagaaca
tcagctgaaaacgagtttgttgttattaagaaggatgtggatgctgcttacatgggcaag
gtggagctggaagccaaagtagatgctctgacagatgaactcaacttcctgaggaccttc
tttgaagctgaactgggtgagttgcaggctcagatctctgacacctctgttgtcctgtcc
atggacaataaccgagctttggatctggaaagcatcatcgctgaggtgaagtctcagtat
gaagacatagcgaagaagagcagagctgaagctgaatctgtttaccaaggcaaggttcaa
gagttgcaggcatctgcaggtgaacaaggagatgttctgcgcaacacgaagagtgagatc
tctgagctcaaccgcaaatcccagagactgaaagctgaaattgaaaatgtcaagaaacag
atcgccaagctgcaagcatctataactgaagcggaggagcgtggggatcttgttctgaaa
gatgctcagtcgaaactcgccgagctggaggctgctctgcaaaaggttaagcaggacatg
gctcgccagcttcgggaataccaggaactcatgaatgtgaaactggctctggatgttgaa
attgctacttacagaaaactgctggaaggagaagaattcaggcttaattcagatgtcaat
aatgtcagcatttctgtcattagttctggtggcaaaagttccctaggaggaggaggtggt
ggatctggagcaggattcggcttcggaagtggtggtgctgcctttggtggaagtggaggg
gctgcctttggtggaagtggtggcgctgcctttggtggcagtggcgtttcctttggctca
ggaggtggtggattcagctcctcaagctcctcatttggtggtggtgtcggcagtgtgcga
tattcatccagtcaatccagctacaggagttaa

DBGET integrated database retrieval system