KEGG   Xenopus tropicalis (western clawed frog): 100496752
Entry
100496752         CDS       T01011                                 

Definition
(RefSeq) histone H2A type 1
  KO
K11251  histone H2A
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100496752
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xtr03036]
    100496752
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xtr04147]
    100496752
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100496752
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100496752
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 100496752
NCBI-ProteinID: XP_002940883
UniProt: F6XTM2
Position
6
AA seq 130 aa
MSGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKK
AESSKPAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtccggcagaggcaaacaaggcggcaaggttcgggctaaggccaagacccgctcatcc
cgggctgggctgcagttcccagttggccgtgttcaccgcttgctgaggaaaggcaattat
gccgagcgggtgggagccggagctccggtctatctggccgcagtactcgagtacctgacc
gctgagatcctggagttggctgggaacgctgcccgggataacaagaagacccgcatcatc
cccaggcacctgcagctcgctgtgcgcaacgatgaggagctgaacaaactgctcggaggg
gtgactatcgctcagggcggggtcctgcccaacatccagtccgtgctgctgcccaagaaa
gccgagagctccaagccggccaagggcaagtaa

DBGET integrated database retrieval system