KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_0795
Entry
YpsIP31758_0795   CDS       T00570                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YpsIP31758_0795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypi02044]
    YpsIP31758_0795
Secretion system [BR:ypi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YpsIP31758_0795
SSDB
Motif
Pfam: IcmF-related IcmF_C T3SS_needle_reg Phage_holin_3_6 DUF4131
Other DBs
NCBI-ProteinID: ABS48665
UniProt: A0A0U1R0L2
Position
954541..957963
AA seq 1140 aa
MKRIALPIKKPEVWFWIVALLFLLAGAVLCWLVWQHPERVGLIQGTPQRDRWLTGLVVGT
GILTLCALLSYVGTRLSGRKHFDEIRQQAQGDDVSLLKENAKVGDIQQSELSHLKTRLRR
RYGLFWRYKVRLLMVVGEPDEIAALAPQLAEQGWLEGQRTVLIHGDSVQSPADETGLSEW
RKLRRGRPFDGIVWAITAAQSSHPQWMDNGLRTLEKMGATLRYQPPVYLWQVCGSGWPQD
TRVEQPVGVVFPAKATPEQVELQLRALLPQLREQGMQQLSVEPHHDFLLRLAQSLEQGDA
TRWRQRLTPWFTEYAARIPLRGLMFSLPEVSTSAARVHEKNWTASDRWQGILDDCRSARG
RRVGLPWEQTLCYSLLALIVLWGVGSVVSFAVNRHQMVSAAQQAQQLAQSQAVSDQQLMA
LQALRNDIGRLQSRVAQGAPWYQRFGLDHNAPLLEVLMPWYGQANNRILRDATAQSLHQK
LSELAELPANSPQRAVLAKTGYDQLKAYLMMSRPEKADAAFYAQVMQTTEPVRAGVSPGL
WQSLAPDLWQFYAQNLPAQPDWKIKPDTGLVSQVRQVLLGQIGQRNAESTLYENMLLSVR
RNYADMTLTDMTGDTDAQRLFQTSESVPGMFTRKAWDEQIQQAIDKTVASRREEIDWVLS
DNRRAISEDISPEALKKRLTERYFTDFAGSWLSFLNSLHWNEAHNLSDVIDQLTLMSDVR
QSPLIALMNTLAWQGQTGQQNQALSDSLVKSAKALMNKDQAPAIDQSAGGPVGPLDETFG
PLLALMGKGDAQNRLSSDSSLSLQTLLTRVTRVRLKLQQVVNASNPQEMTQVLAQTVFQG
KSVDLTDTQEYGSLIAASLGEEWSSFGQTMFVQPLTQAWETVLQPSSASLNDQWKNAVVA
NWKSAFDGRYPFAASKSDASLPMLAEFIRKDSGRIDSFLTRELGGVLHKEGTRWVPSKVN
SQGLTFNSDFLAAINQLSQVSDILFTDGSQGLRFELLARPVPNVVETHLAIDGQKLHYFN
QMESWQSFRWPGDTYKPGTLLTWTGVNSGARLYGDYQGTWGLIRWLEQAKQKKLDEGRYQ
LTFTTADNLPLQWILRTELGKGPLGLLQLRNFTLPAQIFLIQSAPSAASDRTDDEDMAED
NT seq 3423 nt   +upstreamnt  +downstreamnt
gtgaagcgcattgccttaccgattaaaaagccagaagtctggttctggattgttgctctg
ttatttttgctggcgggtgccgtgttgtgctggctggtctggcaacatccagaacgggta
ggattaattcagggaacaccgcaacgtgatcgctggctgacgggactggtggtgggaaca
gggatactgaccttgtgcgcattactgtcgtatgtggggacccgattatccggcagaaaa
cactttgatgagatacggcagcaggcacaaggtgatgatgtgtcgttgctgaaagaaaac
gcgaaggtgggagatattcagcagagcgaactgtcccatttgaaaacccgtctgcgccgc
cgttacgggctgttctggcgctacaaagtccggttgctgatggtggtgggagagcctgac
gaaatcgctgcattggctccgcaactggcggaacagggctggctggaagggcagcgtacg
gtgctgattcacggtgatagtgtccaaagtccagccgatgaaaccgggctgagtgagtgg
cgtaaactgcgccgtggccgcccgtttgatggcattgtttgggcgataaccgccgcgcaa
agtagtcatccacagtggatggacaacggcctgcggacgctggagaaaatgggcgcaacc
ttgcgctatcaaccgccggtgtatctgtggcaggtctgcggcagcggctggcctcaggat
acgcgggtggagcagccggtcggggtggtgttcccggcgaaggccacgccagagcaggtt
gagcttcaactgcgcgctctgttgcctcagttacgtgagcaggggatgcagcagctttct
gtcgaaccgcaccatgatttcttgttgcgtctggcgcagtcgctggagcagggcgatgcc
acccgctggcggcagcgtctgacgccgtggtttaccgagtatgcggcgcgtattcccctg
cgtgggttgatgttcagtttgccggaggtatcaacatcggcggcgcgtgtgcacgagaaa
aactggactgcatctgaccgctggcaggggatactggatgactgtcgttctgcccgtgga
cgccgtgtcgggctgccgtgggagcagacattgtgctacagcttgctggcactgatagtg
ctgtggggcgtgggcagtgtcgtgtcatttgcggtcaaccgtcaccaaatggtctctgcc
gcgcagcaggcacagcaactggcgcagtcgcaagcggtctctgaccagcaactcatggcc
ctacaagccctgcgcaatgatatcgggcgcttacaatctcgcgtggcgcagggggcacct
tggtatcagcgctttggcctggatcataatgcgccgctgcttgaggtcctgatgccgtgg
tatggccaggccaacaaccgcattcttagggatgctaccgcgcaaagcctgcatcagaaa
ctcagtgaactggcggagctgcccgccaacagcccgcaacgtgcggtactggcaaaaaca
ggctatgaccagttaaaggcctatctgatgatgtcacgtccggaaaaagccgatgctgca
ttttatgcacaggtgatgcagaccaccgagcctgtgcgtgccggtgtatctcctggtctg
tggcagagtctggccccagacttatggcaattttatgcgcaaaacctgcctgctcagccg
gactggaaaattaaaccggataccgggttggtaagccaggtacggcaggtcttactgggg
cagattggtcagcgcaatgcagaaagtacgctgtatgaaaacatgctgctatcagtgcgt
cgcaactatgccgacatgacgctgacggacatgaccggcgacactgatgctcagcgtctg
ttccagacctcggaatccgtgcccggtatgtttacccgcaaggcctgggatgagcaaatc
cagcaggcaatagataaaacggtggcctcccgccgcgaagagattgactgggtattgagt
gataaccgccgggcgatatccgaagatatctcaccggaagcgctgaaaaaacgcctgacc
gaacgttatttcaccgattttgctggcagttggctgagtttcctcaacagtttgcactgg
aatgaggcgcataacctgtcggatgtgattgaccaactgaccttgatgagtgatgtacgc
cagtcgccgctgattgcgctaatgaacacgctggcgtggcaagggcagaccgggcagcag
aatcaggcattatcggattcgctggtgaagtctgccaaggcgctgatgaataaagaccag
gctccggcgattgaccagagtgccggtgggccagtagggccactggacgagacctttggc
ccgttgctggcactgatgggcaaaggcgatgcacaaaacaggctgtcgtcggacagctcg
ctgagcctgcaaacgttgctcacccgcgtgacccgggtgcggcttaaactccagcaagtg
gttaatgcctcgaacccacaagagatgactcaggtgctggcccagaccgttttccagggg
aaaagtgtcgacctgacggacacgcaggagtacggcagcctgattgccgccagtctgggg
gaagagtggagcagtttcgggcagacgatgtttgttcagccgctgacgcaggcgtgggag
accgtgttgcaaccttcgtcggccagccttaacgaccagtggaaaaacgcggtggtggcc
aattggaaatcagcctttgacgggcgttacccgtttgccgccagtaaaagcgatgcttca
ctgccgatgctggccgaatttattcgtaaggatagcgggcgtatcgacagcttcctgacc
cgtgagctgggtggcgtgctgcataaagaagggacgcgctgggttccgagtaaagtgaac
agccaggggctaacgtttaactcggactttctggcggccattaatcaactgagtcaagtc
tccgatattctgttcactgacggcagtcaggggctgcgctttgagctactggcacgcccg
gttccgaatgtggtggaaacccatttagcgattgatggacagaaattgcattatttcaac
cagatggaaagttggcagagtttccgctggccgggtgatacctacaaacccggcacgcta
ttgacctggactggcgtgaattccggggcccgtttatacggtgattatcaggggacatgg
ggattgatccgctggctggaacaggcaaaacagaaaaagctggatgaagggcgttatcaa
ctgaccttcaccaccgcggataacctaccactgcaatggatattacgcactgagctgggc
aaaggtccattaggtctgctgcaactgcgtaactttaccctgcctgcgcaaatttttctg
atacagagcgccccttcagcggcatctgatcggaccgatgatgaggatatggcagaggat
taa

DBGET integrated database retrieval system