KEGG   Yokenella regensburgei: HEC60_20715
Entry
HEC60_20715       CDS       T06519                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
yre  Yokenella regensburgei
Pathway
yre00230  Purine metabolism
yre01100  Metabolic pathways
yre01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:yre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HEC60_20715 (xdhA)
Enzymes [BR:yre01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     HEC60_20715 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: QIU91558
UniProt: A0A6H0KE84
Position
complement(4298961..4301264)
AA seq 767 aa
MDELEAAVTGESCMRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAQTIDSTAA
RALPGVLAVFTWEDVPDTPFATAGHAWSLDPNKRDLADRLLLHRHVRHHGDAVAIVVARD
ELTAEKAAHLVHVEWESLPVITSPEAALAEDAIALHEDGNLLKSSEIMANDPLGAISGAD
HQFSSHFQTAVVQHCHMEGVTSFAWMEEDKRITIVSSTQIPHIVRRITAQALGMSWSSIR
VIKPYIGGGFGNKQDVLEEPMAAFLTSRLGGIPVKVSLSREECFMASRTRHAFTIDAQLG
MDKDGTLKGYHLDVLSNTGAYASHGHSIAAAGGNKISYLYPRSAFGYHARTCYTNFPSAG
AMRGYGAPQVIFPLESLMDDAAAALNLDPVDVRLRNVAQEGDVNPVNHKTIYSAGLPECL
RKGRELFEWDKRRAEYASDQGNLRRGVGVACFSYGSNTWPVGVEISGARALLNQDGCIHV
QCGATEIGQGADTVFTQMVAETIGMPVNMVHVISTQDTDVTPFDPGAFGSRQSYVAAPAL
REAAQQLREKIILHAAEMLHQSAMNLTIRHGMVEMTTRPGLTMVSVADVAMDAFYHPDRG
NQLSAEASVKTRTNPPTFGCSFVDLTVDIALCKITINRILNVQDSGRILNPQLAAGQMHG
GMGMGIGSAIFEEMIIDETSGLIRNPNLLDYKMPTMMDLPDLECAFVESCEPQSAYGHKS
LGEPPLIPIAPAIRNAVRMATGVGINTLPLTPKRLFIEFRRAGLIKG
NT seq 2304 nt   +upstreamnt  +downstreamnt
atggatgagctggaagcggcagtcaccggggaatcttgcatgcgcgttgacgccatcgca
aaagtcaccggccgcgcgcgctacaccgacgactacgtcatggcagggatgtgctacgcg
aaatatgttcgcagcccaatagcccacggctatgcacagactatcgacagcaccgcagca
agggcgttacccggggtgcttgccgtgttcacctgggaagatgtcccggacacacctttt
gccaccgccggccacgcctggtcgttggatcccaataaacgcgatctcgccgatcgcctt
ctgcttcaccgtcatgttcgccatcacggtgacgcggtggcgattgtggtcgcccgcgac
gaactgacggccgagaaggccgcgcacctggttcacgtcgagtgggaatcgcttcccgtc
atcacctctcccgaagccgcgctggctgaagacgccattgcgctgcacgaagacggtaac
ctgctcaaaagcagtgaaatcatggcgaacgatccgctgggagccatctctggcgcggat
caccagttcagtagccactttcagaccgcagtggttcagcattgccatatggaaggtgtc
accagcttcgcatggatggaagaagataagcgcatcacaatcgtttccagtactcagatc
ccgcacattgtccgccggatcaccgcccaggcgctggggatgtcatggtcttcaattcgc
gtcatcaaaccctacattggcggcggctttggcaataaacaggacgtcctcgaagagcca
atggcggcatttttaacctcgcggctcggcggcattccggtaaaggtgtccctcagccgg
gaagagtgctttatggcaagccgcacccgccacgcgttcaccattgacgcacagctgggg
atggataaggacggcaccctgaagggctatcatctcgatgtgctgtctaataccggtgca
tatgcctcgcatggtcattcgattgcggcagcaggcggtaacaaaatcagttatctctac
ccgcgcagcgcctttggctatcacgcccgcacctgctacaccaacttcccatccgccgga
gcgatgcgcggctacggagcgccgcaggtgatattcccactcgaatcactcatggacgat
gccgccgcggcgcttaatcttgacccggtggacgtacgtctgcgcaacgtcgcccaggaa
ggtgacgtaaacccggtgaaccacaaaacgatttacagcgccggtttaccggagtgcctg
cgcaaaggtcgggagctgtttgagtgggacaaacgtcgcgccgaatacgcgagtgaccag
ggcaaccttcggcgcggtgttggagtggcctgcttcagctacggctctaacacctggccg
gtgggcgtggagatttccggtgccagagcgttgctcaaccaggatggttgtattcacgtg
cagtgcggtgccacagaaatcggccagggtgctgatacggtatttacccagatggtggcc
gaaaccatcggtatgccggtcaacatggtgcacgtgatttcaacccaggataccgacgta
acgccgttcgatcccggtgcttttggctcgcgccagagctatgtcgccgccccggcgcta
agagaggcagcacaacagcttcgcgagaaaatcattctgcacgccgctgaaatgctgcat
cagtcggcgatgaatctcactatccgccacgggatggtggaaatgaccacccgtccggga
ctgacaatggtctccgtcgccgatgtggcaatggatgccttctatcatccggatcgcggt
aaccagctttcagcagaggcctcggtgaaaacccgcaccaacccacccacctttggctgc
tcgtttgtcgatctcaccgtcgatatcgcgttgtgcaaaatcaccatcaaccggatcctc
aacgtgcaggattccgggcggatcctcaatccacagctggcagcaggccagatgcacggc
ggaatggggatggggatcggcagcgccattttcgaggagatgatcatcgatgaaaccagc
gggcttatccgtaacccaaacctgctggattacaaaatgccaaccatgatggatcttccg
gatctggagtgcgcctttgtcgaaagctgcgagccgcagtcagcctacggccacaagtcg
cttggcgaaccaccgttaatcccgatagcgcccgccattcgtaatgccgtccgtatggcc
accggtgtggggattaacacgctgccgctaacgccaaagcgcctgttcattgaattccgt
cgggccggactgattaaaggataa

DBGET integrated database retrieval system