KEGG   Zhongshania aliphaticivorans: AZF00_07095Help
Entry
AZF00_07095       CDS       T04315                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K05296  3(or 17)beta-hydroxysteroid dehydrogenase [EC:1.1.1.51]
Organism
zal  Zhongshania aliphaticivorans
Pathway
zal00984  Steroid degradation
zal01100  Metabolic pathways
zal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:zal00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    AZF00_07095
Enzymes [BR:zal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     AZF00_07095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AMO68085
UniProt: A0A127M4A8
Position
1616239..1617015
Genome map
AA seq 258 aa AA seqDB search
MGRVNGKVCIVTGAASGMGKADAIMLAAEGAKVVLTDLNEADGQAVAAQIGESAIFVKHN
VTSEEDWQRVVSTAVAHFGRLDVLVNNAGMMTLGNVVDCSLEDYRRVNAVNSEGVFLGCK
TAIPAMEASGNGGSIINMSSVAAIHGMSFVAAYSASKGAVMALTKSVALYCREKRNGIRC
NSIHPDGVKTPMVFKVATGQDSATREEIESLSTVEHPMCEPEDIAALVLYLASDESKFVN
AAEMLIDNASTATPPIGM
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtgtaaacggcaaggtatgcatagtaacgggtgcggcaagtggcatgggcaag
gctgacgcgattatgctcgccgccgagggtgcaaaagtggtgctgacagaccttaacgag
gccgacggccaggctgttgccgcgcaaattggagagtctgccatttttgtgaaacacaat
gtgacgagcgaagaagattggcagcgggtagtgagcacggctgtggcgcattttggccgc
ttggatgtgctggtgaataacgctggtatgatgaccttgggtaatgttgttgattgtagt
cttgaggactaccggcgtgttaatgcggtcaacagcgagggtgtttttctaggctgtaag
acggcaataccggcaatggaagcgtcgggtaatggtggttccatcattaatatgtcctcg
gtggcggcgattcatggcatgtcttttgtggcggcgtacagcgcgagcaaaggagcggta
atggcgttgaccaagtcggtagcgctgtattgccgtgaaaagcgcaatggcatccgctgt
aattctattcaccccgatggcgttaaaacgcccatggtatttaaagttgcaaccggtcaa
gattccgccaccagagaagagattgaatccctttctaccgttgaacacccaatgtgcgag
ccggaagatattgctgcgctggtgctttatttggcatcggatgagtcgaagtttgtgaat
gcagcggaaatgttgattgataatgcttccactgcgacaccgccaattggcatgtaa

DBGET integrated database retrieval system