Marivirga arenosa: QYS47_34020 Help Entry QYS47_34020       CDS       T10278                                  Symbol trxA Name (GenBank) thioredoxin   KO K03671   thioredoxin Organism marp  Marivirga arenosa Brite KEGG Orthology (KO) [BR:marp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:marp03110]     QYS47_34020 (trxA) Chaperones and folding catalysts [BR:marp03110]  Protein folding catalysts   Protein disulfide isomerase    QYS47_34020 (trxA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 AhpC-TSA TraF Thioredoxin_7 Redoxin Thioredoxin_3 Thioredoxin_9 OST3_OST6 Thioredoxin_6 Glrx-like DIM1 TXD17-like_Trx Glutaredoxin Motif Other DBs NCBI-ProteinID:  WNB17476 UniProt:  A0AA51ZVG1 Position complement(3456929..3457228) Genome browser AA seq 99 aa AA seqDB search MASFGDLIKSETPVLVDFYADWCGPCKMMAPYLEEVAQKMKGKVKVIKVDVDRNQQASMK YQVQSIPTLILFQNGQIKWRQAGVVDPNTIMNQINQVAK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggcgagttttggcgatttaattaaaagcgaaacacctgttttggtcgatttttatgct gattggtgtggcccttgcaaaatgatggcaccctatctagaagaggtggctcaaaaaatg aaagggaaagtaaaagttattaaagttgatgtagacagaaatcagcaggcatcaatgaaa tatcaagtacaaagcatacctactttaattctatttcagaatggtcaaattaaatggcgt caggcaggagtggttgacccaaataccataatgaatcaaattaatcaggtagcgaagtga

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (15) Pfam (15) All databases (17) Download RDF

DBGET integrated database retrieval system