Myroides odoratus: I6I89_18385 Help Entry I6I89_18385       CDS       T07632                                  Name (GenBank) thioredoxin family protein   KO K03671   thioredoxin Organism moa  Myroides odoratus Brite KEGG Orthology (KO) [BR:moa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:moa03110]     I6I89_18385 Chaperones and folding catalysts [BR:moa03110]  Protein folding catalysts   Protein disulfide isomerase    I6I89_18385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin TraF Thioredoxin_8 Thioredoxin_7 Thioredoxin_2 Thioredoxin_6 DIM1 HyaE OST3_OST6 Motif Other DBs NCBI-ProteinID:  QQU03727 Position 4159013..4159306 Genome browser AA seq 97 aa AA seqDB search MSKFGDLVTAEVPVLVYFYAQWNEACTAMDTVIYEVAAAMGDQLRIVKIDVAKNNELIDA LRIKKVPTMLLYKKGAMIWRQSGVMETEALLSVTQTL NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaattcggagatttagtaacagcagaagtacctgtattagtatatttttatgcc caatggaatgaagcatgtactgctatggacactgtaatctatgaagttgcagctgctatg ggagatcaattgcgtatcgtaaaaattgatgtagctaaaaataatgagttaatcgatgcg ttgcgcattaagaaagttcctacgatgttgttgtacaaaaaaggagctatgatttggaga caaagcggagtaatggaaacagaagccttactcagcgtaacgcaaaccctataa

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (9) Pfam (9) All databases (10) Download RDF

DBGET integrated database retrieval system