Ottowia testudinis: J1M35_16130 Help Entry J1M35_16130       CDS       T08188                                  Symbol trxA Name (GenBank) thioredoxin TrxA   KO K03671   thioredoxin Organism otd  Ottowia testudinis Brite KEGG Orthology (KO) [BR:otd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:otd03110]     J1M35_16130 (trxA) Chaperones and folding catalysts [BR:otd03110]  Protein folding catalysts   Protein disulfide isomerase    J1M35_16130 (trxA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 AhpC-TSA Thioredoxin_7 Redoxin TraF OST3_OST6 HyaE Glrx-like Thioredoxin_9 Thioredoxin_3 DUF6568 Thioredoxin_6 Motif Other DBs NCBI-ProteinID:  QTD44601 UniProt:  A0A975CF30 Position 3402073..3402405 Genome browser AA seq 110 aa AA seqDB search MANELIKHVSDSSFETDVLQSDKPVLVDFWAEWCGPCKAIGPTLDELATTYDGKLQIAKI NVDDNRAVPAKFGIRGIPTLMVFKNGQLSATKVGALTKAQLAQFIDQQLA NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggccaatgaattgatcaagcatgtgagcgacagctctttcgaaaccgatgtcctgcaa tccgacaagcccgtgttggtcgacttctgggccgaatggtgcggcccctgcaaggccatc gggcccacgctggacgagctggccaccacctacgacggcaagctgcaaatcgccaagatc aacgtcgacgacaatcgcgccgtgcccgccaagttcggcatccgcggcatcccgacgctg atggtgtttaagaacggccagctgtcggccaccaaggtcggcgcgctgaccaaggcgcaa ctggcgcagttcatcgatcagcaactggcctga

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (14) Pfam (14) All databases (16) Download RDF

DBGET integrated database retrieval system