KEGG   Arthrobacter arilaitensis: AARI_00850Help
Entry
AARI_00850        CDS       T01320                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
aai  Arthrobacter arilaitensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aai00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
83182..83760
Genome map
AA seq 192 aa AA seqDB search
MSELQEIDQPRIAAAVREILEAIGEDPDRDGLVDTPKRVAKAYAEFFAGLHQDAADHLAT
TFDIEHDEMVLVKDIPFYSTCEHHLVPFYGSAHIGYIPGKGGKVTGLSKLARLVEVYARR
PQVQERLTTQIVDALVEHLSPSGAIVVVECEHMCMSMRGVRKPGAKTVTSAVRGQLRETA
TRAEAMSLILGK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaactacaagagattgatcagccgcggatcgcggcagccgtgcgcgagatcctg
gaggccattggcgaagatccggaccgcgacggcctggtagacaccccgaaacgggtagcc
aaggcctacgcggaattcttcgccggcctgcaccaggacgcggcagaccacctggccacc
accttcgacatcgagcacgatgagatggtgctggtcaaggacatcccgttctactcgacc
tgcgagcaccacctggtgccgttctacggttcggcgcatatcggctacatcccgggcaag
ggcggcaaggtcactggcctgtccaagctggcccggctggttgaggtgtacgcccgccgt
ccgcaggtccaagaacgcctgaccactcagatcgtcgacgccctggtggagcacctgagc
ccctccggtgccattgtcgtcgttgaatgcgagcacatgtgcatgtccatgcgcggggta
cgcaagcccggcgcgaagaccgtgaccagcgcggtgcgcgggcagttgcgtgaaactgcc
acccgcgccgaagccatgagcctgatcctcggaaagtag

DBGET integrated database retrieval system