KEGG   Arthrobacter arilaitensis: AARI_02170Help
Entry
AARI_02170        CDS       T01320                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
aai  Arthrobacter arilaitensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aai00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
222573..223196
Genome map
AA seq 207 aa AA seqDB search
MAKLYFRYGAMNSGKSTSLLQAAFNYEERGQRILLAKPGVDTKGENSIVSRLGIQREVDF
TVGPQENVREKFAAHSSGDDPDALLPHVDAPPVACLLVDEAQFLSGEQVDDLLRIAVMDD
VPVLAYGIRTDFRTRAFPGSARLMELAHSLEELKTICRCGRKAMFNTRRVGQCVVFDGDQ
VAIDGDDVWYESLCATCYLQASGGKLS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggccaagctgtatttccgctacggggcgatgaactcgggcaagtccacgagcttgctt
caggccgctttcaactacgaggaacgcggccagcgcatcctgctggccaagcccggggtg
gacaccaaaggagagaactccatcgtttcccggctgggcatccagcgcgaagtcgacttc
accgtggggccgcaggagaacgtgcgcgagaagttcgcagcgcatagttccggcgatgac
cctgatgccctgctgccgcatgtggacgcgccgccggtagcctgcctgctggtggacgag
gcgcagttcctctcgggtgaacaggtcgatgacctgctacggattgctgtcatggatgat
gttccagtgctggcctacgggatccgcaccgacttccgcacccgtgctttcccaggatcg
gcacgcctgatggaattggcgcactcacttgaagagctgaagaccatctgccgctgcggg
cgcaaggccatgttcaatacccgccgggtagggcagtgtgtggtgttcgacggagaccag
gtcgccattgacggcgacgacgtatggtacgaatcgctgtgcgccacctgctatcttcaa
gcctccggcggcaagctgagctag

DBGET integrated database retrieval system