KEGG   Arthrobacter arilaitensis: AARI_23860Help
Entry
AARI_23860        CDS       T01320                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
aai  Arthrobacter arilaitensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aai00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:aai00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2688839..2689414
Genome map
AA seq 191 aa AA seqDB search
MTPAPRHARDLEPLIGAIWAQAENGIIGANGTMPWHVPEDLAHFKRTTAGHPVIMGRATW
NSFPAKFRPLPGRTNLVLTRDVSAHEQLRQDGAEPVSNLEEAIALAKASTGGEEIWIIGG
GQVYAQALELLDLAVITKLEVAAQGDTSAPQLTADFALGTSDPSLDSEAARWHTSSTGTR
YRFETWLRQKD
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacccctgcgcctcgccacgcacgcgatctcgaacccctgattggcgccatctgggcc
caagctgaaaacggcatcatcggcgccaatggcaccatgccctggcatgttcctgaggac
ttggcccacttcaagcgcaccactgccggacacccggtcatcatgggccgtgccacctgg
aattcttttccggcgaagttccgcccgttgcccggacgcaccaatctcgtgctcacccgc
gatgtctcagcccacgaacagctgcgccaagatggggctgaaccggtatccaacctggaa
gaggccattgcgctggccaaggcaagcaccggcggtgaagagatctggattatcggcgga
ggccaggtctatgcccaggccttggaactgctggacctcgcggtgatcaccaagcttgag
gtagcggcccagggagatacttccgcaccccagctgactgccgacttcgccttgggcacc
agcgatccctcgctagattcggaagctgcccgctggcacacttcctccaccggtacccgc
taccgctttgaaacctggcttcgccaaaaggactag

DBGET integrated database retrieval system