KEGG   Candidatus Solibacter usitatus: Acid_4926Help
Entry
Acid_4926         CDS       T00412                                 

Definition
alcohol dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid_4926
  Energy metabolism
   00680 Methane metabolism
    Acid_4926
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Acid_4926
Enzymes [BR:sus01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Acid_4926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6220552..6221766)
Genome map
AA seq 404 aa AA seqDB search
MKAVVYKGKNKVAVEEVSNPKIEAPGDVIVKITTAAICGSDLHMYEQRSNAEPGTVFGHE
NQGVVEEVGNGVVSIKRGDRVVLPFNIACGFCFNCARGYTNACLTANPEAPTAGYGYAGM
GPYRGGQAEFLRVPFADFNCLKLPGQPGDQFEDDFVLLADIFPTGWHAAELANVKGGDSV
AVFGAGPVGLLSAYSAFIKGASEVYVVDRAPDRLARAKSIGAIAVDFTQGDPVEQIKELR
SKNRAHSQALRPGEEKMAGVNCAIDAVGYQARSQSDPDREDPMQTIRQITDIVNPTGSVG
LIGVYFDEDPGGVDKHAKKGEFLFPLGKLWSKGITIGQGQAPVKKYNVYLRDLIIAGKAK
PSFIVSHRLPLARAEEAYAHFDHRGVGSGKDWTKVLLKPEMKAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtggtttataaaggaaagaacaaagttgccgtagaagaggtctccaatccc
aaaatcgaggctcccggcgacgtgattgtgaaaatcacaacggcggcgatctgcggcagc
gacctgcacatgtatgagcagcgcagtaacgccgaacccggaaccgtttttggacacgag
aaccagggcgtggtggaagaggtgggcaacggagtcgtctccatcaagcggggcgaccgc
gtagtgctgccctttaacatagcctgcggtttctgtttcaactgcgcgcggggttacacc
aacgcctgcctgaccgccaaccccgaggcgccgaccgccggctacggctacgccggtatg
ggaccataccgcggcggccaggccgagttcctgcgagtgccgttcgcggacttcaattgc
ctcaaactccccggccagcccggagaccagttcgaggacgatttcgtactgctcgccgat
attttcccgaccgggtggcatgccgcggaacttgcgaacgtaaaaggcggcgattcggtc
gccgtcttcggcgccggtccggtgggcctgctctccgcatacagcgcgttcatcaagggc
gcatcggaggtgtacgtagtggatcgcgcgccggaccggctggcgcgcgcgaagagcatc
ggagccatagcggtggattttacccagggcgatccggtggagcagatcaaggaactccgc
tccaagaaccgcgcgcattcacaggcgctccggcccggggaagagaagatggcgggggtc
aattgcgccatcgacgcggtgggctaccaggcccgcagccagtctgatccggaccgggaa
gaccccatgcagactatccggcagatcaccgacatcgtcaacccgacaggttcggtaggc
ttgatcggcgtgtacttcgacgaagatccgggcggcgtggacaagcacgccaagaaaggc
gaattcctgttcccgctgggcaagctttggagcaaaggaatcacgatcggccagggacag
gccccggtgaaaaaatacaacgtgtatctacgcgacctgattatcgccggcaaagctaaa
cccagcttcatcgtgagccaccggttgcctctggcaagggcggaggaggcctacgcgcat
ttcgatcatcgtggagtcggcagtggcaaagactggaccaaggtcctgttgaagccggaa
atgaaggcagcctag

DBGET integrated database retrieval system