KEGG   Vitis vinifera (wine grape): 100233141Help
Entry
100233141         CDS       T01084                                 

Gene name
DFR, dfr1
Definition
dihydroflavonol reductase (EC:1.1.1.219)
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:vvi00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
18
AA seq 337 aa AA seqDB search
MGSQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTL
WKADLADEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTV
RRLVFTSSAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKE
NNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIY
LFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDL
GFEFKYSLEDMFTGAVDTCRAKGLLPPSHEKPVDGKT
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgggttcacaaagtgaaaccgtgtgcgtcaccggtgcctccggtttcatcggttcatgg
ctggtcatgaggctcctggagcgcggctacactgttcgggccaccgttcgcgatccaact
aacgtgaaaaaagtgaagcatttgctggacttgcccaaagcggagacgcatctgactctc
tggaaggcagatcttgctgatgaaggaagtttcgatgaagctattaaaggctgcaccggc
gtcttccatgttgccacacccatggattttgaatcgaaggatcctgagaatgaagtgata
aagccaactattgaagggatgttgggcataatgaaatcgtgtgctgccgcaaagactgtc
agaaggcttgtattcacatcctccgcaggaactgtgaacattcaagaacaccaactgcca
gtgtacgatgaaagctgctggagtgatatggaattttgccgggctaaaaagatgactgca
tggatgtactttgtctccaagacactggctgagcaagctgcatggaagtatgccaaggaa
aataacattgacttcatcactatcataccgactcttgtggttggccccttcataatgtca
tcaatgcctccaagcctcataactgctctttccccgatcactggaaacgaagctcattat
tcaattatacggcagggccaatttgttcacctggatgacctctgcaatgctcatatttac
ttgtttgagaatcctaaggcagagggacgttacatttgctcctcccacgattgtatcatt
ctcgatcttgcaaaaatgcttagagaaaaataccccgagtataatatccccacagagttc
aaaggtgttgatgagaacttgaagagtgtctgtttctcctccaagaagctgacagatttg
gggtttgagtttaaatacagcttagaggacatgtttactggagctgtggacacatgccgg
gccaagggattgcttcccccttcacatgagaaacctgtagatggcaagacctag

DBGET integrated database retrieval system