KEGG   Vitis vinifera (wine grape): 100263345Help
Entry
100263345         CDS       T01084                                 

Definition
(RefSeq) triosephosphate isomerase, cytosolic
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100263345
   01230 Biosynthesis of amino acids
    100263345
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100263345
   00051 Fructose and mannose metabolism
    100263345
   00562 Inositol phosphate metabolism
    100263345
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100263345
Enzymes [BR:vvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100263345
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100263345
  Exosomal proteins of bladder cancer cells
   100263345
  Exosomal proteins of melanoma cells
   100263345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 254 aa AA seqDB search
MGRKFFVGGNWKCNGTGEEVKKIVSTLNAGEVPSGDVVEVVVSPPFVFLPLVKSTLRPDF
HVAAQNCWVKKGGAFTGEISAEMLVNLGIPWVIIGHSERRLLLNESNEFVGEKVAYALSK
GLKVIACVGETLEQRESGSTMEVVAAQTKAIADKVSNWANVVLAYEPVWAIGTGKVATPA
QAQEVHSELRNWFQANASPEVAATIRIIYGGSVSGANCKELAAKPDVDGFLVGGASLKPE
FIDIIKSAEVKKNC
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggcagaaaattcttcgtcggcggcaactggaaatgcaatggaaccggggaagaggtc
aagaagatagtgtctactcttaatgcaggcgaagtgccgtcaggggatgttgttgaggtt
gtcgtgagccctccatttgtgtttcttccattggtgaaaagcaccttgaggcctgatttt
catgttgcggcacaaaattgttgggtcaagaagggaggtgctttcaccggtgagattagt
gctgagatgcttgtcaatttgggcataccatgggtcattattggtcattctgaaagaaga
cttctgttgaatgaatcaaatgagtttgtgggagagaaagttgcctatgcactttctaaa
ggccttaaggtgatagcttgtgttggagagactcttgagcagcgagaatctggatcaact
atggaagttgttgctgcacaaacaaaagcaattgcagataaggtatcaaattgggctaat
gttgtcttagcctatgagcctgtgtgggctattggaactgggaaggttgctactccagct
caggctcaagaagtacattctgaattgaggaactggtttcaagcaaacgccagtcctgag
gttgctgcaacaatccgaattatctatggaggttccgtcagtggtgcaaactgcaaggaa
ttggcagccaaacctgatgttgacggctttttggttggtggagcttctctaaagcctgag
tttattgacattatcaagtccgccgaggtgaagaaaaattgctaa

DBGET integrated database retrieval system