KEGG   Vitis vinifera (wine grape): 100263345Help
Entry
100263345         CDS       T01084                                 

Definition
triosephosphate isomerase, cytosolic-like
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100263345
   01230 Biosynthesis of amino acids
    100263345
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100263345
   00051 Fructose and mannose metabolism
    100263345
   00562 Inositol phosphate metabolism
    100263345
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100263345
Enzymes [BR:vvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100263345
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100263345
  Exosomal proteins of bladder cancer cells
   100263345
  Exosomal proteins of melanoma cells
   100263345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 254 aa AA seqDB search
MGRKFFVGGNWKCNGTGEEVKKIVSTLNAGEVPSGDVVEVVVSPPFVFLPLVKSTLRPDF
HVAAQNCWVKKGGAFTGEISAEMLVNLGIPWVIIGHSERRLLLNESNEFVGEKVAYALSK
GLKVIACVGETLEQRESGSTMEVVAAQTKAIADKVSNWANVVLAYEPVWAIGTGKVATPA
QAQEVHSELRNWFQANASPEVAATIRIIYGGSVSGANCKELAAKPDVDGFLVGGASLKPE
FIDIIKSAEVKKNC
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggcagaaaattcttcgtcggcggcaactggaaatgcaatggaaccggggaagaggtc
aagaagatagtgtctactcttaatgcaggcgaagtgccgtcaggggatgttgttgaggtt
gtcgtgagccctccatttgtgtttcttccattggtgaaaagcaccttgaggcctgatttt
catgttgcggcacaaaattgttgggtcaagaagggaggtgctttcaccggtgagattagt
gctgagatgcttgtcaatttgggcataccatgggtcattattggtcattctgaaagaaga
cttctgttgaatgaatcaaatgagtttgtgggagagaaagttgcctatgcactttctaaa
ggccttaaggtgatagcttgtgttggagagactcttgagcagcgagaatctggatcaact
atggaagttgttgctgcacaaacaaaagcaattgcagataaggtatcaaattgggctaat
gttgtcttagcctatgagcctgtgtgggctattggaactgggaaggttgctactccagct
caggctcaagaagtacattctgaattgaggaactggtttcaagcaaacgccagtcctgag
gttgctgcaacaatccgaattatctatggaggttccgtcagtggtgcaaactgcaaggaa
ttggcagccaaacctgatgttgacggctttttggttggtggagcttctctaaagcctgag
tttattgacattatcaagtccgccgaggtgaagaaaaattgctaa

DBGET integrated database retrieval system