KEGG   Acidovorax citrulli: Aave_2764
Entry
Aave_2764         CDS       T00451                                 
Name
(GenBank) conserved hypothetical protein
Organism
aav  Acidovorax citrulli
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 FtsK_SpoIIIE HerA_C AAA_16 AAA_10 AAA_22
Other DBs
NCBI-ProteinID: ABM33332
UniProt: A1TQU4
Position
complement(3036787..3039045)
AA seq 752 aa
MSEAVMEGLLRPPVEGWSAATAYGIAGVAVAAPWALMMPQPLGLVTGAIAAAFGTVRARE
ALHVYRYQRGLKFTKITRVAPHRLPVTREHLYLGEGFEWTQKHTQRKLDTQAKKVQEYVR
PSGMERQLAEAGERIRKWVDSKPKDPVRKAVRAAVDLGGTANPFATGVDLGGNPILHGVG
VLEERPVKLRQTSRSGHMLVMGTTRVGKTRLLELLSTQDIHAGHVVIVIDPKGDAELMLR
MQAEARRAGREDSFYLFHLGYPEISARYNGIGNFARITEVAGRATNALPSAGNSAAFKEF
SWRFTNIVAQAQVALGRIPTYETLLKDVTGIDPLFMDYANMVFRKLAAEGRFADYEDRLH
DLQKAIQAKKAPVPRSLADRAPELVAMYLWIKESRLEDKVLLGLAAAFSYERSFYEKIVA
SLGPFLEKLTSGAVGKLISPDYFDPDDKRPIFDWMTVFRQGGIVYAGLDALSDSVVSSAV
GNSMLSDLVSTGGKLYKTGLNPHSQDGKLQLPTVCCHFDEVNEIAGPEFVPMVNKLGGSG
FRITAYTQSMFDIEAKVGDKAKAGQIMDNFNHLVMLRVRSVATANLMAEQLPQVNVVHLT
PMSGVSDTAAKGDGVDFLSRNDDIVTSVKSPLFEASDILELPQGQAFALLEGNRRFKIRI
PLADTTDDPFIPQSLKVVAEDMKRRYRTSERWAAETDWLGTQPLGAGAAGLIDTHLADDD
GDDDAGTAAVHGTHGSALSHSAVMGNLMGHQQ
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgagcgaggcggtcatggaaggcctgctgcggcctccggtcgagggttggagcgccgcc
acggcctacggcatcgcgggcgtagcagtggccgcgccttgggcactgatgatgccgcag
ccgctcggcctggtgaccggtgccatcgccgccgcgttcggcaccgtgcgggcccgcgag
gcgctgcacgtgtatcgataccagcgcggcctgaaattcaccaagatcacgcgcgtcgcc
ccgcacaggctccccgtgacacgcgagcacctgtacctgggcgaaggcttcgagtggacg
cagaagcacacccagcgcaagctcgacacccaggccaagaaggtgcaggagtacgtcagg
ccgagcggcatggagcggcaactggcggaggcgggcgagcgcatccgaaagtgggtggac
tccaagccgaaggatcctgtccgaaaggcggtgcgcgccgcggtagacctgggcggcacc
gctaaccccttcgccacgggtgtggacctgggtgggaaccctatcctgcacggcgttggc
gtgctcgaagagcgtccggtcaagctgcggcagacctcccggtcaggccacatgctcgtg
atgggcaccacgcgggtcggcaagaccaggctgctcgaactgctctccacccaggacatt
cacgcgggtcatgtggtcatcgtgattgatccgaagggcgatgccgagctcatgctccgc
atgcaagcagaggcgcgccgcgccggacgcgaagacagcttctacctgttccacctcggg
tatccggagatcagtgcccggtacaacgggatcggcaatttcgcgcgaatcaccgaggtg
gcgggcagggcaacaaacgccctgccctcggccggcaactctgcggcgttcaaggagttc
tcctggcggttcaccaacatcgtcgcgcaggcgcaggtggcgctgggccgcatcccgact
tacgagacgctgctcaaggatgtgaccgggatcgacccgctgttcatggactacgcgaac
atggtgtttcgcaagctggcggccgaggggcggttcgccgactacgaagaccggctgcat
gatctgcagaaggccatccaggcgaagaaggcgccggtaccgcgcagcctcgcggaccgc
gcccccgagctcgtggccatgtacctgtggatcaaggaatcccggctcgaggacaaggtg
ctgctcggcctggccgcggcgttctcctacgagcggtccttctacgaaaaaatcgtcgcg
tccctgggcccgttcctggagaagctcacctcgggcgcagtgggcaagctcatctcgccg
gactacttcgacccggacgacaagcgtcccatcttcgactggatgaccgtgttccgccaa
ggcggcatcgtctacgccggcctggatgcgctctcggactccgtggtgtcgtcggccgtc
ggcaactcgatgctgtccgacctggtctccacgggcggcaagctctacaagaccggcctg
aacccgcacagccaggacggcaagctccaactgccgacggtgtgctgccacttcgatgag
gtgaacgagatcgccggccccgagttcgtgcccatggtgaacaagctgggcggctcgggc
ttcaggatcacggcctacacccagtccatgttcgacatcgaggccaaggtgggcgacaag
gccaaggccggccagatcatggacaacttcaaccacttggtcatgctccgcgtgcggtcc
gtcgccacggccaacctcatggccgagcagctgccgcaggtgaacgtggtccacctcacg
ccgatgagcggcgtgagcgacacggcggccaagggcgacggagtggacttcctgtcccgc
aacgacgacatcgtgacctcggtgaagtcgccgctcttcgaggcctcggacatcctggag
ctgccgcaggggcaggcattcgcgctgctcgaaggcaacaggcgtttcaagatccgcatt
ccgctggcggacaccaccgacgaccccttcatcccccagtccctcaaggtggtcgcagag
gacatgaagcgccggtaccgcaccagcgagcggtgggccgcggaaaccgactggctgggc
acgcagccgctgggcgccggcgccgccgggctcatcgacacgcatctggccgacgacgac
ggtgatgacgacgcgggcactgcggcagtccacggcacgcacggatcggcgttgtcgcac
agcgcggtgatgggcaacctcatgggtcaccagcaatga

DBGET integrated database retrieval system