KEGG   Acinetobacter baumannii ACICU: ACICU_p0058
Entry
ACICU_p0058       CDS       T00710                                 

Definition
(GenBank) Type IV secretory pathway, VirD4 component
Organism
abc  Acinetobacter baumannii ACICU
SSDB
Motif
Pfam: TrwB_AAD_bind TraG-D_C T4SS-DNA_transf DUF87 ATP-synt_ab PsaA_PsaB ABC_tran MeaB
Other DBs
NCBI-ProteinID: ACC59034
Position
pACICU2:26558..28717
AA seq 719 aa
MKAKNNSKAIEFTRGSEIWIHQFRMFISSMMNVIVFGLMITIGIVCAFLYIKLKDVHFLA
LSVQYDIWLKSVFNNPDARVALKLNGVVRDYTLDQAQHIINPYFNQLKFYVFRAFILGIL
LSSFLVGGLIYYWFTYGKEVMSDEQIRGSELVSNDALIYKIQSTKGFSPYKISNIPMVKN
TEGTNVGIFGAPGSGKSQIFRDHLSQVRNNKRKAIVYDPSGEFTSEFYRPGIDIILNPFD
ERMPYWSPFFEIRHDEHFDSIANAFVPVEGKDPYFGEAGRTVLAEVMRELHANGIHSNKT
LHDTIAHFTIEEISSVLEGTAASKHVDKKAEKTALAVLTTVQNKLRAFRYLPDSGTQFSI
RDWVSRPEEDSWIFLSLREEQKTTIEPLITLWFSIFIKAVMNLEPIHRELLWMYCDEFPT
LPKMDDLPLSLTNTRKFGLCHFLGLQDIPQLEEKYGEKIARSIISALQTKVFYRVNENET
AKRMSEILGQMEVAEKNMSRSMGVNDSRDGDSFITQRRERFIVLPSEIMKLPDLTGYLRV
PGDYPVTKITQKYHPHLKNVPAFIERENMGFISAFAVAEALESQSNSDGKEPLVEQQNEE
GNFFGNSTVPLVGNSSFFGKSNTTSENIYENSPLDLFHSQTEDSDLSLNEKNGIQPDEII
PDEDEKPKVVNNDRLHTFASYLAATDESSVQKNNDVTPDTNSSNDSNESSFKDLFNNND
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgaaagcaaagaataactcaaaagcaatcgaatttacgagaggttctgaaatatggatt
catcaatttcgaatgtttatttcaagcatgatgaatgtcatagtttttggcctgatgatt
acgattggcattgtatgtgcatttctatacattaaattaaaggatgttcattttcttgct
ttaagtgtgcaatacgatatttggttaaagtcagtatttaataatccagatgcgagagta
gcactgaagctaaatggtgttgtacgtgattacactcttgatcaagctcagcacattatt
aatccctattttaaccaattaaagttttatgtttttcgagcatttattttaggtattctt
ttaagctcatttctagtcggtggtcttatttattactggtttacttatggtaaggaagta
atgtctgatgaacaaattcgtggttcagaactagtttctaatgacgcattaatttataaa
atccaaagtacgaaaggattcagtccatataaaatttctaacatacctatggtaaaaaat
acagaaggtacgaatgttggtatttttggtgctcctggttctggtaagtctcaaattttt
agagatcatttatctcaggttagaaacaataaaagaaaagctatcgtttatgatccttca
ggagaattcacttcagaattttatcgaccaggtatagatattattctaaatccatttgat
gaacgtatgccgtattggtcaccattttttgaaattcgtcatgatgagcatttcgatagt
attgctaatgcttttgttccagttgagggtaaagatccttattttggcgaagctggtaga
acagtattagctgaagtcatgcgtgaattacatgctaatggtatacactcaaataagact
ctccatgacacgattgcacattttactattgaagaaatatcgtctgtgcttgagggaacg
gctgcttcaaagcatgttgataaaaaagctgaaaagacggcactggctgttcttacaaca
gtacaaaataaattaagagcatttcgctatttaccagattccggtacacagttttctata
cgtgattgggtaagtcggcctgaagaagactcatggattttcctttcgcttagagaagaa
cagaaaactactattgaaccacttattacgttgtggttttcaatattcattaaagccgta
atgaacttagaaccaatacatcgtgaactattatggatgtattgtgatgagttcccaact
ctaccaaaaatggatgatttacctttatctcttacaaatactcgtaaattcggtttatgt
cattttttaggactacaagatattcctcaacttgaagaaaagtacggagaaaaaattgct
cgttcaataatttcagctttacaaacgaaagtgttctatcgagttaatgaaaatgaaact
gcgaaaagaatgtctgaaattcttggacagatggaagttgctgaaaaaaatatgtctaga
agtatgggggttaatgattcaagagacggtgatagttttattactcaaaggagagaacgc
tttattgttttaccatctgaaattatgaagttgccagatctaacaggatacttaagagtt
cctggtgattatccagttacgaagattactcagaaatatcatcctcacttaaaaaatgtt
ccagcatttatagaacgagaaaatatgggtttcatttctgcgtttgcggttgctgaagct
ttagaatcccaatcgaattctgatggaaaagagccattagtagaacaacaaaatgaagaa
ggcaatttctttgggaattctactgtgccacttgttggaaatagtagtttctttgggaaa
tctaatacaacctctgaaaatatttatgaaaattcacctttagatttatttcattctcaa
acagaagatagtgatttatcacttaatgaaaaaaacggtattcaaccagacgaaataatc
ccggacgaagatgaaaagcctaaagttgttaataatgacagactacatacttttgccagc
tatcttgccgcaaccgatgaatcaagtgttcagaaaaataatgacgttactcctgacact
aattcaagtaatgattctaatgaatctagttttaaagacttgttcaataacaatgattag

DBGET integrated database retrieval system