KEGG   Anolis carolinensis (green anole): 100555060
Entry
100555060         CDS       T01608                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  ecotropic virus integration site 1 protein
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100555060 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acs03000]
    100555060 (mecom)
Transcription factors [BR:acs03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    100555060 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-H2C2_5 zf-C2H2_jaz zf-BED SET zf-C2H2_11 RGS12_us1 zf-C2H2_8 PyrI_C
Other DBs
NCBI-GeneID: 100555060
NCBI-ProteinID: XP_008104256
Ensembl: ENSACAG00000015620
Position
3
AA seq 1267 aa
MRSKARARKLATNNECVYESFHEILLEETPENDGEPSTLSLSIHEQSSPATSSEAFTPKE
GSPYRAPIYIPDDIPIPSEFELRESNILGAGLGIWTKRKIEVGERFGPYAGEHRPSLKDP
SHGWEILDEYYNVKFCVDASQPDVGNWLKYIRFAGCYNQPNLVACQISDQIYYRVVREIE
AGEELLLFMKTEDYLHETMAPDIHEERQYRCEDCDQLFESKAELVDHQKFPCSTPHSAFS
MVDEDFQPKLDKENDLHDLHDIQECKECDQVFSDVQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFAT
SSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSS
LNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKSSMVNMNHANPGLADYFGANRHPAGL
TFPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLPSTDQTTKSQSPLMTHPQTLPATQ
DILKALNKHPPNLSENKPVELQPEGSSEERPHEKISDHSESSDLDDVSTPSGSDLETTSG
SDLESDIESDKEKCKENGKMFKDKVNSLQNLASVNNKKEYSNHSIFSPSLEEQTAVSGAV
NDSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRPL
PLKMEPQSPGEVKKILKGNSESPFDLTTKRKEEKPLTPITSKPATPSVTNQDQPLDLSMG
SRSRASGTKQTEPRKNHIFGGKKGELNPESRKSSDISLQHARPTPFFMDPIYRNGDLHCN
RRCFTQELKTRCTIATQRGTQGVEKRKLSDPLEALKEKYLRPSPGFLFHPQFQLPDQRTW
MSAIENMAEKLESFSALKPEASDLIQSVPSMFNFRAPPSTLPENLLRKGKERYTCRYCGK
IFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFG
QQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDSYFTEIRNFIGNSNHNNSE
ERMNGSHFKDETNLVASQNSDLLEDEEAEDEVMMDEEEEESEITGKPMKELATSSICEEA
TEGTYEEGNALEINCKSSPGRYKEDEFNKTGLSALDHIRHFTDSLKVRKIEENQFSEAEL
ATFSTSHLSEDLKTPLHRKSKSQAYAMMLSLSDKDSLHSPSHNSSNVWHSMARAAAESGA
IQSISHV
NT seq 3804 nt   +upstreamnt  +downstreamnt
atgcgatccaaagccagagcgaggaaactggccacaaataatgagtgtgtatatgaaagc
ttccatgaaattcttttggaagagacacctgaaaatgatggagagccaagcactttgtca
ctcagcatccacgaacaatcttctccagcaacgtcaagtgaagccttcacaccaaaggaa
ggatctccttacagagctccgatatacattcctgatgacatcccaattccatctgagttt
gagcttcgagaatcaaatattcttggagctggattagggatatggaccaaaaggaagatt
gaagtaggtgaaagatttggaccatatgcaggagaacatcgaccaagtcttaaagatcct
agtcatggatgggagatcttggatgagtattacaatgtgaaattctgcgttgatgccagt
cagccagatgtaggaaactggctaaagtatatcagatttgctggatgctataatcagccc
aaccttgttgcatgtcaaataagcgatcagatatattatagagtggtgagagaaattgaa
gctggagaagaactccttcttttcatgaagactgaagactatttacatgaaacaatggct
ccagacattcacgaggagcgtcagtatcggtgtgaagactgtgaccagctatttgagtcc
aaagcagaactggtggaccatcagaaatttccatgcagcacgccccactccgcattttca
atggtggatgaagattttcagccaaagcttgacaaggagaatgacctccatgacttgcat
gacatccaagaatgcaaagagtgcgatcaagtgttctccgatgtgcaaagcttagaaaag
catatgctatctcacaccgaagaaagggagtacaagtgtgaccaatgtcccaaagccttt
aactggaaatccaacttgatacgccatcagatgtcccacgacagtggaaagcactatgag
tgtgaaaactgtgccaagcaggttttcacggaccccagcaacctccagaggcatattcgt
tcgcagcacgttggggctcgtgcccacgcttgtccggagtgtggtaaaacatttgccact
tcttcaggcctcaaacagcacaaacatatccacagcagtgtcaagccttttatatgtgag
gtctgccataaatcctatactcaattttcaaacctttgccgtcataagcgtatgcatgct
gattgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttcc
ttaaataaacacaggagattttgtgagggcaagaaccattttgcggcaggaggatttttt
ggccaaggcatatcacttcctggaaccccagctatggataaatcttccatggttaatatg
aatcatgcaaatccgggccttgctgactattttggtgccaataggcatcctgctggtctt
acctttccaacagctcctggattttcttttagcttccctggcctgtttccttcagggtta
taccacaggccacctttgatacctgctagttctcccgttaaaggacttccaagcacagac
caaacaaccaaaagtcaaagtcccctcatgacacatcctcagacactgccagctacccag
gacattttgaaggcactaaataagcacccacctaacctaagtgaaaataagccagtggag
cttcaaccagaggggtcctccgaagagaggccacatgaaaagatcagtgaccactcagag
agtagtgaccttgatgatgtcagtacccccagtgggagtgacctggagaccacttctggc
tctgatctggaaagtgacattgaaagtgataaagaaaaatgtaaagaaaatggtaaaatg
ttcaaagacaaagtaaactctcttcagaatttggcttccgtaaataataagaaagaatac
agcaatcattccatcttctcaccatctttagaggaacaaactgcggtgtcaggagctgtg
aatgattctataaaggccattgcctctattgctgagaaatactttggttcgacaggactt
gtggggctacaggacaaaaaagttggagccttaccttacccttccatgtttcccctccca
ttttttccagcattctctcagtcaatgtacccatttcctgatagagacttgagaccgtta
cctttgaaaatggaaccccaatcgccaggagaagtaaagaagatcttaaagggaaactcc
gagtctccctttgatcttaccactaaacgtaaggaggagaaaccacttactcctataacc
tcaaaaccagcaacaccatcagtgaccaaccaggaccagcctctagatttgagtatgggc
agcagaagtcgagctagtggtacaaaacagactgagcctcggaaaaaccacatctttggg
ggaaagaaaggagaactcaatcctgaatcaagaaaatcatcagacatctctttacagcac
gcaaggccaacacccttctttatggatcctatttacaggaacggcgatctccactgcaat
cgaaggtgtttcacccaagaactcaaaacacgttgtaccatagcaacacaacgtggaact
caaggagtggagaaaagaaagttatctgacccactcgaagctttgaaggaaaaatacttg
agaccatccccaggattcttgttccacccacaattccaattgcctgatcagagaacttgg
atgtcagctatagaaaacatggctgaaaagcttgagagctttagcgccctgaaaccagaa
gccagtgacctcatacaatccgtcccgtccatgttcaatttcagagcccctcccagtact
ttgccggagaaccttttacgaaagggcaaggaacgctatacctgcagatactgtggcaag
atttttccaagatctgcaaaccttacccgtcatctgaggacgcacactggcgaacaacct
tacagatgcaaatactgtgaccggtcttttagcatatcatctaacctgcagagacatgtt
cgtaacatccacaataaggagaagcctttcaaatgtcatctatgtgacaggtgctttggc
cagcaaactaatttagatagacatctcaaaaaacatgagaacggcaacatgtcaggtact
gctacatcttcccctcactctgaactcgaaagcacaggtgctatcttagatgacaaagag
gactcatacttcacagaaattcgtaatttcatcgggaatagcaatcacaacaattcagaa
gaaagaatgaatggaagccactttaaagatgaaacgaatctggtagcaagccagaactca
gacttgttagaagatgaagaagcagaagatgaagtaatgatggacgaggaagaagaagaa
agcgagataacagggaagcctatgaaagagcttgcgacgagcagcatttgtgaagaagcc
actgaaggcacttatgaagaaggaaatgcgttggaaattaactgcaaatcttctcctggc
aggtataaggaagatgagtttaataaaactggactttctgctttggaccacataaggcac
ttcactgacagcctcaaagtgagaaaaatagaagaaaatcagttcagtgaagctgaactg
gcaacattcagcacttcccatctgtcagaagacttaaaaacaccattgcatcgcaaatcc
aaatcacaggcctatgcaatgatgctttcactttctgacaaggactctctccactctcca
tcccacaactcctccaatgtatggcacagtatggcaagagctgctgccgaatctggtgcc
atccaatccattagtcatgtatga

DBGET integrated database retrieval system