KEGG   Addendum: AAB09766
Entry
AAB09766          CDS       T10000                                 

Gene name
dntAc
Definition
(KEGG) 2,4-dinitrotoluene dioxygenase subunit alpha (EC:1.14.12.24)
  KO
K14579  naphthalene 1,2-dioxygenase subunit alpha [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Taxonomy
TAX:69003
  Lineage
Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia
Organism
ag  Addendum (Burkholderia sp. RASC)
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: AAB09766
GB: U62430
UniProt: Q45695
AA seq 451 aa
MRQAIMSYQNLVSEAGLTQKHLIYGDKELFQHELKTIFARNWLFLTHDSLIPSPGDYVKA
KMGVDEVIVSRQNDGSVRAFLNVCRHRGKTIVDAEAGNAKGFVCGYHGWGYGSNGELQSV
PFEKELYGDAIKKKCLGLKEVPRIESFHGFIYGCFDAEAPPLIDYLGDVAWYLEPTFKHS
GGLELVGPPAKVVVKGNWKVFAENFVGDIYHIGWTHASILRAGQAIFAPLAGNAMLPPEG
TGLQATTKYGSGIGVSLDAYSGVQSADLVPEMMAFGGAKQEKLAKEIGDVRARIYRSQVN
GTVFPNNCFLTGAGVFKVFNPIDENTTEAWTYAIVEKDMPEDLKRRLADAAQRSTGPAGY
WESDDNDNMVLSQNAKKYQSSNSDLIADLGFGKDVYGDECYPGVVSKSAFSETNHRGFYR
AYQAHISSSNWAEFENTSRNWHTELTKTTDR
Reference
PMID:8759857
  Authors
Suen WC, Haigler BE, Spain JC
  Title
2,4-Dinitrotoluene dioxygenase from Burkholderia sp. strain DNT: similarity to naphthalene dioxygenase.
  Journal
J Bacteriol 178:4926-34 (1996)
DOI:10.1128/JB.178.16.4926-4934.1996

DBGET integrated database retrieval system