KEGG   Addendum: BAB92014
Entry
BAB92014          CDS       T10000                                 

Definition
(KEGG) trimerelysin I (EC:3.4.24.52)
  KO
K21897  trimerelysin I [EC:3.4.24.52]
Taxonomy
TAX:88087
  Lineage
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Lepidosauria; Squamata; Bifurcata; Unidentata; Episquamata; Toxicofera; Serpentes; Colubroidea; Viperidae; Crotalinae; Protobothrops
Organism
ag  Addendum (Protobothrops flavoviridis)
SSDB
Motif
Pfam: Reprolysin Pep_M12B_propep Reprolysin_5 Disintegrin ADAM_CR Reprolysin_3 Reprolysin_4 Reprolysin_2 Peptidase_M66 Pex2_Pex12 Peptidase_M57 Peptidase_M10 DUF4041
Other DBs
NCBI-ProteinID: BAB92014
GB: AB074144
UniProt: P20164
AA seq 614 aa
MIQVLLVTICLAVFPYQGSSIILESGNVNDYEVMYPQKVAALPKGAVQQKYEDTMQYEFK
VNGEPVVLHLEKNKGLFSEDYSETHYSPDGREITTNPPVEDHCYYHGRIQNDADSTASIS
ACNGLKGHFKLQGEMYLIEPLKFSDSEAHAVYKYENVEKEEEAPKMCGVTQTNWESDEPI
KKASKLVVTAEQQRFPRRYIKLAIVVDHGIVTKHHGNLKKIRKWIYQLVNTINNIYRSLN
ILVALVYLEIWSKQNKITVQSASNVTLDLFGDWRESVLLKQRSHDCAQLLTTIDFDGPTI
GKAYTASMCDPKRSVGIVQDYSPINLVVAVIMTHEMGHNLGIPHDGNSCTCGGFPCIMSP
MISDPPSELFSNCSKAYYQTFLTDHKPQCILNAPSKTDIVSPPVCGNELLEAGEECDCGS
PENCQYQCCDAASCKLHSWVKCESGECCDQCRFRTAGTECRAAESECDIPESCTGQSADC
PTDRFHRNGQPCLYNHGYCYNGKCPIMFYQCYFLFGSNATVAEDDCFNNNKKGDKYFYCR
KENEKYIPCAQEDVKCGRLFCDNKKYPCHYNYSEDLDFGMVDHGTKCADGKVCSNRQCVD
VNEAYKSTTVFSLI
Reference
  Authors
Kishimoto M, Takahashi T
  Title
Molecular cloning of HR1a and HR1b, high molecular hemorrhagic factors, from Trimeresurus flavoviridis venom.
  Journal
Toxicon 40:1369-75 (2002)
DOI:10.1016/S0041-0101(02)00179-4
Reference
PMID:2398046
  Authors
Takeya H, Oda K, Miyata T, Omori-Satoh T, Iwanaga S
  Title
The complete amino acid sequence of the high molecular mass hemorrhagic protein HR1B isolated from the venom of Trimeresurus flavoviridis.
  Journal
J Biol Chem 265:16068-73 (1990)

DBGET integrated database retrieval system