KEGG   Addendum: CAA48323
Entry
CAA48323          CDS       T10000                                 

Definition
(KEGG) jararhagin (EC:3.4.24.73)
  KO
K20139  jararhagin [EC:3.4.24.73]
Taxonomy
TAX:8724
  Lineage
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Lepidosauria; Squamata; Bifurcata; Unidentata; Episquamata; Toxicofera; Serpentes; Colubroidea; Viperidae; Crotalinae; Bothrops
Organism
ag  Addendum (Bothrops jararaca)
SSDB
Motif
Pfam: Reprolysin Pep_M12B_propep Reprolysin_5 Disintegrin ADAM_CR Reprolysin_3 Reprolysin_4 Reprolysin_2 ADAM_CR_2 Peptidase_M10 Peptidase_M66 Peptidase_M57 DUF4953
Other DBs
NCBI-ProteinID: CAA48323
GB: X68251
UniProt: P30431
AA seq 571 aa
ATRPKGAVQPKYEDAMQYEFKVNGEPVVLHLEKNKGLFSKDYSEIHYSPDGREITTYPPV
EDHCYYHGRIENDADSTASISACNGLKGYFKLQRETYFIEPLKLPDSEAHAVFKYENVEK
EDEAPKMCGVTQNWKSYEPIKKASQLAFTAEQQRYDPYKYIEFFVVVDQGTVTKNNGDLD
KIKARMYELANIVNEIFRYLYMHVALVGLEIWSNGDKITVKPDVDYTLNSFAEWRKTDLL
TRKKHDNAQLLTAIDFNGPTIGYAYIGSMCHPKRSVGIVQDYSPINLVVAVIMAHEMGHN
LGIHHDTGSCSCGDYPCIMGPTISNEPSKFFSNCSYIQCWDFIMNHNPECIINEPLGTDI
ISPPVCGNELLEVGEECDCGTPENCQNECCDAATCKLKSGSQCGHGDCCEQCKFSKSGTE
CRASMSECDPAEHCTGQSSECPADVFHKNGQPCLDNYGYCYNGNCPIMYHQCYALFGADV
YEAEDSCFKDNQKGNYYGYCRKENGKKIPCAPEDVKCGRLYCKDNSPGQNNPCKMFYSND
DEHKGMVLPGTKCADGKVCSNGHCVDVATAY
Comment
Incomplete sequence.
Reference
PMID:1385408
  Authors
Paine MJ, Desmond HP, Theakston RD, Crampton JM
  Title
Purification, cloning, and molecular characterization of a high molecular weight hemorrhagic metalloprotease, jararhagin, from Bothrops jararaca venom. Insights into the disintegrin gene family.
  Journal
J Biol Chem 267:22869-76 (1992)

DBGET integrated database retrieval system