KEGG   Acinetobacter indicus: CTZ23_13545Help
Entry
CTZ23_13545       CDS       T05342                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
aid  Acinetobacter indicus
Pathway
aid03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aid00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CTZ23_13545 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aid03400]
    CTZ23_13545 (recD)
Enzymes [BR:aid01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CTZ23_13545 (recD)
DNA repair and recombination proteins [BR:aid03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CTZ23_13545 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Helicase_RecD Viral_helicase1 SH3_13 UvrD-helicase DUF2075 PhoH AAA_22 ResIII Herpes_Helicase T2SSE Mg_chelatase PIF1 AAA UvrD_C
Motif
Other DBs
NCBI-ProteinID: AVH15198
UniProt: A0A2L2J685
Position
complement(2781149..2782924)
Genome map
AA seq 591 aa AA seqDB search
MDNQRTVLTATPETQTPAWFALWSNYLLQAPFFQAEKREDSAKIIAQLLEATLNGDSCIA
ASAEQVAALANLVGSGSEPGSVAPFIYDQQHLYLYRYWALESALAQQVARLKQQAVTAVD
VSDYLHLLEDQHQQQALKMTATTAFNLITGGPGTGKTYTLARIIAVLNQALPEIRIAMAA
PTGKAAQRMKEALQNSFDDPKIANLVSDDLKRLTPITIHRLLGLGNRQQPRFHARQPLPY
DLIVIDEASMLDLNLASMLFNAIAEQTRVILLGDAQQLASVDVGSVLADLQQVPALADNH
VHLVTSRRFKAGALIGEMARFIQQQTAEQPAAQILQQFAAQLVQPGELQAVTLTQDMADV
LQLEYLPDEAPDPIAGQGYYDKLMLGYQGYVHSLKQYLQADDPDAVVTQVVKAFDQYRIL
TAIRHGGLGLQQLNMQIEQRLLQQLALDVAKQGDWYVGRPVMMTYNDYQLGLSNGDIGLC
LQRLREGNRQFEVYFPSLDKWVPATRLPKNIETAFTLTIHKSQGSEFQHVAVVLDQAAQN
LLSKELIYTAITRAKSVVSLLADRQALVQALTVKTSRNSGVLEKVNEHLSL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
gtggacaaccagcggacagttttaacagcaacgcctgaaacccaaaccccggcatggttt
gcgctttggagtaactatcttttacaggcgcctttttttcaggcggaaaagcgagaagat
tccgctaaaatcatcgcgcagttgctggaggctactctcaatggtgacagctgtatagcc
gcttctgccgaacaggtggcagcgttggccaatctggtcggttccggttctgaaccgggt
tcggtggcgccgtttatttatgaccagcagcatttatacctgtaccgttattgggcgctg
gagtcggcgctggcacagcaggtggcacgcttaaaacagcaagctgttacggcggtagat
gtgtcggactatctgcatttattggaagaccagcaccagcagcaggcgctcaaaatgacc
gcgactaccgcttttaacctgattacgggcggcccgggtaccggtaaaacctatactttg
gcgcggattattgccgtgctaaaccaggccttgccggaaatccggattgccatggcggcc
ccgaccggaaaagccgcgcagcgtatgaaagaagcactgcagaattcctttgatgatccg
aaaattgccaatctggtcagtgacgatctcaaacgcctgaccccgattaccatccaccgg
cttttgggccttggcaaccggcagcagccacgttttcatgcccggcagcctttaccttat
gacctgattgtgattgatgaagcctccatgctggacctgaatctggccagtatgctgttc
aatgccattgctgaacagacccgggtgattttactgggagatgcgcagcagctggcgtcg
gtcgatgttggttcggtactggctgatttacagcaggtgccggcactggcagataatcat
gtgcatctggtcaccagtcgccgttttaaagccggtgccttaattggtgaaatggcccgc
tttattcagcagcaaacggctgaacagccggccgcgcaaatcttgcagcagtttgccgca
cagctggtgcagccgggcgaattacaggccgtaactttaacgcaggacatggccgatgta
ctgcaactggaatatttacccgatgaagccccggatcccatagccgggcagggctattat
gacaaactgatgctgggctatcagggctatgtgcacagcttaaaacagtatttacaggcc
gatgatccggacgcggtggtgacgcaggtggtgaaagcctttgaccagtaccggattctg
actgcaattcgtcatggtggcttaggcctgcaacagctgaatatgcagattgagcagcgt
ttgctgcagcaactggctctggatgtggccaagcagggcgactggtatgtcggccggccg
gtgatgatgacctataacgactatcagctcgggctgtccaacggtgatattggcctgtgc
ctgcaacgtctgcgtgagggcaaccggcagtttgaagtgtatttcccgagtctggataaa
tgggtgccagccacacgcttgccgaaaaatattgaaaccgcatttaccctgaccattcat
aaatctcaaggttcggagtttcagcatgtggcggtggtgctggatcaggccgctcagaat
ctgctgagcaaggaactgatctataccgccattacccgggccaaatctgtggtgagttta
ctggccgaccggcaggcgctggtacaggccttaaccgtgaaaaccagccgtaacagtggt
gtattagaaaaagtaaatgaacatttatcattataa

DBGET integrated database retrieval system