KEGG   Austrofundulus limnaeus (annual killifish): 106523993
Entry
106523993         CDS       T06063                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106523993 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:alim03000]
    106523993 (mecom)
Transcription factors [BR:alim03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    106523993 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-H2C2_5 zf-C2H2_jaz zf-C2H2_6 zf-C2H2_8 zf-BED PyrI_C
Other DBs
NCBI-GeneID: 106523993
NCBI-ProteinID: XP_013873050
UniProt: A0A2I4BZ76
Position
Unknown
AA seq 1265 aa
MRSKGRARKLATSDDSDDFALYPANILDDVCDSTGDPSLSSTLAEDPLSDDELSPQSIQQ
PNMFIAQTDLAIPLDFELRESAVPGAGLGIWSRRKVNIGERFGPFEGEHRPCLQDPAQGW
EILDGSGHVKFCVDASKPDAGSWLKHIQFAPAXSQHNLTACQIDDQIFYKVTREIFPGEE
LLLFMKAEEYPCDTMAPDIHEERQYRCEDCDQNFESRSQLLDHQKQPCGMPPSSFLNPGG
DSDLKAQEPQDLRPLHMSHGLHECKDCDQVFPDVQSLEAHILSHSEEREYKCDQCPKAFN
WKSNLIRHQMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATS
SGLKQHKHIHSSVKPFMCKSLRPYLCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQ
MFSTTSSLNKHRRFCEGKNHFTAGGLFAQGLPLPGTPGLDKSALAIGHTSAGLADYFGAS
RHHTGLTFPAAPAFPFSFPGLFPSGLYHRPPLIPATTSPVRQPSHAPVAGPGSELCKSPL
LPSSPSALESQELLKALRKDGGSPGNQIPDSELHNQGSSSTTKQRNKQSDQSESSDLDDV
STPSGSDLESTTGSELESDLDSERERGAARENGKGPKRKGHEGGSQSPSFIGSSAAKDFP
GPSLIQSSLDEHTAVTGAVNDSIKAIASIAEKYFGSTGLASLQDKKVGSLPYPSMFSLPF
FPAFSPPVYPFPDRDLRPTXLKGEPQSPGDDGKKSQGKSSSESPFDLTTKRKAEKLVLFA
SSKPEISHPTGEDQPLDLSLGSRGRGRFSNQEEAKKSPGYEEEKRVLEIPKADSSLQHAR
PTPFFMDPIYSRVEKRRMSDPFETLKDKYMRPAPGFLFHPQFRLPDQRTWMTAIENMAEK
LETFGSLKSESSELLRSVPSMFDFRAPPSALPETLLRKGKERYTCRYCGKIFPRSANLTR
HLRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLK
KHENGNLSGTAMSSPQSELDSGSAILDDKEDSYFNEIRNFISKAGQNHTSPDHSEEGLNG
GPLEEGKPLMVSHGSQDLEDEEVEDLDADDEEAEEPSNNSEKREPKVHSSSLSDDIIRDE
MDFSEPNDLNFSCQTSPRRYKDEEELSHYSALDRIHRFSDLRKLEESELSDGDGEEDDRA
FDSPSLTEAVKQPLFRKSKSQAYAMMLSLAEKDSLHSATHTPATMWHSLARAAAESSAIQ
SLSHV
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcacggaaactggccacgagtgacgacagcgatgactttgct
ctctatccggccaacatcttagatgatgtttgtgactctaccggcgacccctcgctttct
tcaaccctggcagaggacccgctgtctgatgatgagttgtcacctcagtcaatccagcaa
ccaaacatgtttatagcccaaactgacctggccatccctctggactttgaactgagagag
tcagcagttccaggtgctggcctgggcatctggagtcgcaggaaggtgaatatcggagag
cgctttggaccttttgaaggagagcataggccttgccttcaagatcccgctcaaggctgg
gagatcttggacgggtcaggccatgtaaagttttgcgtggatgccagcaaaccagacgca
ggcagctggctgaagcacatccagtttgcccccgcgkcctcgcagcataacctgacagcg
tgccagatcgatgatcagatcttctacaaagtcaccagagagatttttcctggagaggag
ctgctacttttcatgaaggctgaagaatatccatgcgacacaatggctcctgatattcac
gaggagaggcagtatcgctgtgaagactgtgaccagaactttgagtcccgcagccaactg
ctggaccaccagaagcagccgtgtgggatgccgccctcttcctttcttaatccaggagga
gacagtgacctgaaagctcaagagcctcaagatttgcggccccttcatatgtctcatggc
ctgcatgagtgtaaggactgtgaccaggtcttccctgatgtccagagcctggaggcccac
attctgtcacactccgaggagcgggaatataagtgtgatcagtgtcccaaggccttcaat
tggaaatcaaacttgatccgacatcagatgtcgcacgacagtggcaagcactacgaatgt
gaaaactgctcaaagcaggtgttcacagaccccagtaacctacagaggcacattcgctcg
cagcacgtcggggctcgtgcccacgcctgctccgactgcggcaaaacctttgcaacgtct
tcgggcctcaagcagcataagcacatccacagcagtgtcaagcccttcatgtgtaagtca
ctaagaccctacctatgtgaggtatgccacaagtcctacacccagttctcaaacctttgc
cggcacaaacgcatgcatgctgactgccgcacgcagatcaagtgcaaggactgtgggcaa
atgttcagcaccacctcatccctcaacaagcatcggcgtttctgtgaaggaaaaaatcat
ttcacagcagggggactgtttgcccagggtctgccactccctggcacccctggcttggac
aaatcagccctggcaattggtcacaccagtgctggactggctgattactttggggctagc
cgccaccacaccgggcttactttccctgcagccccagcatttcctttcagcttcccaggc
ttgtttccttctggactctatcaccgaccaccactcattcctgctacgacctctcctgtc
agacagccgtctcatgcacctgttgcagggcctggttcagagctgtgtaaaagtcccttg
cttccttcaagccctagcgcgttggagtctcaagagctgctgaaagctctccgaaaagac
ggtggttcacctggaaaccagataccagactcagagctccataatcagggttcatcttca
accacaaagcagcggaacaagcagagtgaccagtctgaaagcagtgacctggatgatgtc
agcacgccaagtggaagtgatctggagagtacaacgggctctgagcttgaaagtgacctg
gacagtgaaagggaaagaggagctgctcgagaaaayggcaaaggtcctaagagaaagggc
catgaaggaggctcccagagccccagtttcataggcagcagtgctgctaaagactttcca
ggcccttcccttatacagtcttcactagacgagcatacagctgttacgggggctgtgaat
gactctataaaggccattgcctctattgctgaaaaatattttggctcaactgggctagct
agcttgcaagacaaaaaggttgggtctctgccctacccctccatgttctcactgcctttc
ttcccagctttctctccaccagtttaccctttccctgacagggacctcagaccaacagrc
ctgaaaggtgagccacaatcaccaggagatgatggcaagaagagccaaggcaagtcttca
tctgagtcaccatttgacctcactaccaaaagaaaggcagaaaagttagtcctttttgcc
tcrtctaaaccagagatctcgcatcccactggtgaagatcagccactcgatctgagcctt
gggtcgaggggtcgaggacgtttttcaaatcaggaggaggccaaaaagagcccaggctat
gaggaggagaaaagagttttggagattccaaaagcagattcctctttacagcatgccagg
cctactcctttttttatggaccccatctacagcagggttgagaagaggaggatgagcgat
ccgtttgagacgctgaaagacaaatacatgaggccagctccaggtttcctgtttcatcca
cagtttcgtttgccagatcagagaacttggatgacggctattgaaaacatggcagagaag
ctggagacgtttggctccttgaagtcagaatccagtgaactgttgcgctccgttccatcc
atgttcgacttcagagccccgccgtctgcccttccagagacgctgctgcgcaagggcaag
gagcgctacacgtgcagatactgcggaaaaatatttcctcgctctgctaacctgactcgg
cacctcaggactcatacaggagagcaaccatacaggtgtaaatactgcgaccgctccttc
agcatctcctccaacctgcagcgtcacattcgcaacatccacaacaaggagaagcccttc
aagtgccacctgtgcgaccgctgcttcggccagcagaccaacctcgaccgtcacctcaaa
aagcacgagaacggcaacttgtcaggaactgcgatgtcatccccgcagtctgaactggac
agtggtagtgccatattggacgataaagaggattcctactttaatgaaataaggaatttc
atcagtaaagcgggacagaaccacacatcaccagatcactccgaggaagggctgaatgga
ggtccattagaagaagggaaaccattgatggtaagccacgggtcacaagatctggaagat
gaggaagtggaagacctagacgctgatgatgaagaagcggaagaacctagcaacaattct
gagaaaagggaacccaaggtgcactctagcagtcttagtgatgacatcatacgagacgaa
atggacttcagcgagccaaatgacttaaacttcagctgtcaaacatctccaaggaggtat
aaggacgaagaggaactgagccactactcggccttggaccgcattcatcgtttttctgac
ctgcgcaagctggaggagagtgagttgagtgatggagatggagaagaggacgacagagcg
tttgactctccttctctgacggaggcagtcaaacagccactctttaggaaatcgaagtct
caggcgtatgccatgatgctgtctctggctgaaaaggactctcttcactcagccactcac
accccggcgaccatgtggcatagcttggcacgggccgctgctgaatccagcgccatccaa
tccctcagccatgtatga

DBGET integrated database retrieval system