KEGG   Alteromonas naphthalenivorans: ambt_20940
Entry
ambt_20940        CDS       T01513                                 
Name
(GenBank) hypothetical protein
Organism
alt  Alteromonas naphthalenivorans
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind T4SS-DNA_transf DUF87
Other DBs
NCBI-ProteinID: AEF05679
UniProt: F5Z716
Position
complement(4700730..4702595)
AA seq 621 aa
MLTYQRHLRRSPRYEMASSQIPVSRSVLFLGRGFRWTQTHTERLYAARDRRAEHYLQPSA
FKQWVRKKEIEWEHTPLLKQLVKLTARDSALNPVRPPPASGGDAVIHGVGIGGESNASMP
LSDRVGHMVVIARTRHGKTRLAELLITQDIHRRDNCVIVLDPKGDADLLKRIHIEAQRAK
RPLLIFHLGYPELSARYNAIGSFSRITEVATRIASQLPGEGDASAFKEFAWQFVNVIAVA
LVALGERPDFLKIRRYITDIDPLLIRYGHYWLDQHGNEQWQEELAEFRNAINVKSLPRVE
QGKDPDAIALVRYLKTQVEFDQVLEGLISAFRYDREYFQKITVAVKPFLEKLTTGNIAAI
LAPDLSDEQDQRPVLEWAHAIRDQAIVYVGLDALTDPEVASAVGESMFSDLTSLAGHIYK
HGIGDNPTQRNQKPPNIVIHGDEFSDLIGPQFKTLINKSGGAGYELNLYTQTWSDPIAEL
GSEAKAGQLAGNIGTVMIMGVKEIATCEMFTKQLPEVSVSEIMAVSGVTDNSEREGGISF
TSNNQDRVSISRVPMISPADIVALPKGQAFVLLKGSELWKIRIPMPSKVDDDELPDDLGE
MLRLMRQGYTSVTDWGSFNGR
NT seq 1866 nt   +upstreamnt  +downstreamnt
gtgttgacctaccagcgccacttacgccgaagtccccgttatgaaatggcttcctcgcaa
attcccgtgagccgttcggtcctgtttttaggccgcggttttcgttggacgcaaacccat
actgaacgcttgtatgccgcccgtgatcgacgtgccgagcattacctgcaacccagtgca
ttcaagcaatgggtacggaaaaaagaaattgagtgggaacatacgccgctgttaaaacag
ttggtaaagttgactgccagagattccgcgttaaatccagtgaggccaccgcccgccagt
ggcggcgatgctgtgattcatggtgtcggtattggcggggagagtaatgccagtatgccc
ttgtcggatcgtgtcgggcatatggtggtcattgctcgaactcgccacggcaaaacccga
ttggcggaactgctaatcacccaagacatccatcgccgagataactgtgtgattgtgtta
gaccccaagggcgatgcggatttgctcaagcgtattcatatcgaagcgcaacgtgccaag
cgtcccttgctcatcttccatttgggctaccccgaacttagcgctcgctataatgccatc
ggttcattctcacgtattaccgaagtggcaacacggattgccagtcagttaccgggagaa
ggcgatgccagtgcctttaaagaatttgcctggcagtttgtgaatgtgattgccgtagcc
ttggttgccttgggcgaacggcccgacttcctgaagattcgccgttatatcactgatatt
gacccgctactgattcgctatggccattactggttagatcaacacggtaatgaacaatgg
caggaggagttggctgaatttcgtaatgctatcaacgttaaatcactaccaagagtcgag
caaggtaaagatccggatgctattgcactggtacgttatctgaaaacacaggtggagttc
gaccaggtattggaaggcctgatttctgcctttcgctatgatcgggagtattttcagaaa
atcaccgtggcggtaaaaccgttcttggaaaagctgactaccggtaatatcgcagcgata
ctggcccccgatttatccgatgaacaggatcagcgccctgtgctggaatgggcgcacgcc
attcgtgatcaagcgattgtgtacgttggcctagatgctctaaccgatccagaagtcgca
agtgcagtcggagagtcgatgttcagtgaccttaccagtctggcggggcatatctataaa
cacggtatcggcgataatccaacacaacgaaaccagaaaccgccgaacatcgtgattcat
ggtgacgagttctccgatttaatcggccctcagttcaagacgctcatcaataaatccggt
ggtgcggggtatgagctgaatctctatacccaaacatggagtgaccccatcgcagagctg
ggcagtgaagctaaggccggacagcttgctggcaacatcggtacggtaatgattatgggg
gttaaggaaatagccacctgcgagatgttcaccaagcaactaccggaggtcagtgttagc
gaaattatggcggtatctggtgtcacggataatagtgaacgcgagggtggaataagtttc
acttctaataatcaggatcgggtaagcatcagtcgtgtacctatgatttctcctgcggat
attgtggccctacccaaaggtcaggcttttgtactactaaagggtagcgagctttggaaa
attcgcatccccatgccctcaaaagtagacgatgatgaactacccgatgacctgggtgaa
atgcttcgcttgatgcgccagggctatacttcagtcactgactggggcagttttaacggg
cgttga

DBGET integrated database retrieval system