KEGG   Apis mellifera (honey bee): 409611
Entry
409611            CDS       T01057                                 
Name
(RefSeq) disintegrin and metalloproteinase domain-containing protein 10 isoform X1
  KO
K06704  disintegrin and metalloproteinase domain-containing protein 10 [EC:3.4.24.81]
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ame01002]
    409611
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ame04090]
    409611
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.81  ADAM10 endopeptidase
     409611
Peptidases and inhibitors [BR:ame01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   409611
CD molecules [BR:ame04090]
 Proteins
  409611
SSDB
Motif
Pfam: Reprolysin_2 Reprolysin_5 Reprolysin_3 Disintegrin Reprolysin_4 Pep_M12B_propep Reprolysin
Other DBs
NCBI-GeneID: 409611
NCBI-ProteinID: XP_006563676
BEEBASE: GB49985
UniProt: A0A7M7GR49
Position
LG15:complement(7909918..8044316)
AA seq 901 aa
MKLVNVICPPSVNAPSTLTFHQGCKHTARRLNEYIRHYEPLSYPTEEVHRGHLRAKRSVT
RDNSVTLKFRSHGRDFHIRLKRDLATFSNNLIIEGPSGQTEDLDTSHIYQGHLVGEPGSH
VFGSISDGVFHGKIISPRGGAWYVEKAYYYFPPHEINDTLHSVIYHENNVDDPYAHLRKG
ETGGCGITDDVVEWMDRIQNSAEPDEERPVTEKKSEPPPVAKPWNGDQESPGHKYSREAN
EPGHRRTRRATRPKEDKKNNTCSLFIQTDPLIWRHISEQLHHDAEKTREEILSLIAHHVT
AVNYIYRDTRFDGRIKHRNIKFEVQRIKIDDDTACTPQQTYGEPNPFCMENIDVSNFLNL
HSLGNHEDFCLAYVFTYRDFTGGTLGLAWVASASGASGGICERYKTYTETVGGMYQSTKR
SLNTGIITFVNYNSRVPPKVSQLTLAHEIGHNFGSPHDFPPECRPGGLHGNYIMFASATS
GDRPNNSKFSKCSIGNISNVLDAIEDKKKKNCFTASAGAFCGNKIVEAGEECDCGYDDNE
CVDKCCYPRQISDLDKMKNDTAKGCTRKSGTQCSPSQGPCCSSESCQFVPLSKNVQCKAE
SDCSYNSTCNGRSSECPPPLPRANKTRCNEGTQLCINGECTGSICLEWNLTECFLTSNVI
PNIDKRKLCELACQNGTDPSTCRSTSEFAHVVGLPEGGISLRPGSPCDNFQGYCDVFLKC
RAVDAEGPLARLKNLLFNKDTLRTVAQWITEFWWAAVLMGIAFIIFMGLFIKCCAVHTPS
SNPKKPPARRISDTLRRPMNTLRRMRHPHGGGAGPRSIPPRQGQGGHGTRGPSHGYGEGR
GAQYYPKAGYRSVPTASAPPSGSAAPNYARSNHPELYAGAYSGSGGGGRASAYEMRHHNK
V
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgaagctcgtgaacgtcatttgcccaccgtcggtaaatgccccgtccactctgacgttt
caccaggggtgtaaacacacagctcgccgtttgaacgaatatatccgccactacgaacca
ctctcttatccaaccgaagaggtccaccgaggtcacttgagggccaagaggtcggttacc
cgcgacaattccgtgactctgaagtttcgctcgcacggaagggacttccacattcggttg
aagcgggatctggccacctttagcaataatttaattatcgaagggccgtccggtcaaacg
gaagacctcgatacgtcccatatttaccagggccacttagtcggcgagcccggcagccac
gtgttcggaagtatcagcgacggcgttttccacgggaaaatcatatcgccccgaggtggc
gcgtggtacgtggaaaaggcgtactattacttcccgccgcacgagataaatgacacgttg
cattccgtcatctatcatgagaataacgtggacgatccgtacgcccatcttcgaaaaggt
gaaacgggaggttgcggcatcaccgacgacgtggtggagtggatggacaggatacaaaat
tccgcggaaccggacgaggaacgtccggtgaccgagaagaaatccgagccgccgccggtg
gcgaaaccgtggaacggtgatcaggagtcgcccgggcacaagtattcgagggaagctaac
gagcctggccacaggaggacgcggagggcgaccaggccgaaggaggacaagaagaacaac
acttgttcccttttcattcaaaccgatcccctgatatggagacacatatcggaacagtta
caccacgacgcggagaagaccagggaggagatattgtctctgatcgcgcatcacgtcacc
gcggtgaattacatttacagagacaccagattcgacgggaggatcaagcatagaaacatc
aagttcgaggtgcaacggataaagatcgacgacgacacggcgtgcacgccccaacaaacg
tacggcgagccaaatcctttctgcatggagaacatcgacgtcagtaactttttaaatttg
cattcgctcggcaaccacgaggatttctgcctcgcgtacgtgttcacctacagagatttt
accggcggtactcttggtcttgcctgggtagcatccgcatctggcgcatccggtggcatt
tgcgagagatacaaaacgtatacggagacggtcggtgggatgtaccagtccaccaagaga
tccttgaacaccgggatcatcactttcgtcaattacaacagcagagtgcctcctaaagtg
tcgcagttgacgttggcccacgagatagggcacaattttggatcgcctcacgattttcca
cccgagtgtaggccgggtggcctccacggaaattacatcatgtttgcttctgcgacgagc
ggggaccggccgaacaacagcaaattttcgaaatgcagtatagggaatatcagtaacgtg
ttggacgccatagaagacaagaagaagaaaaattgtttcaccgcctctgctggagctttc
tgcggtaataagatagttgaagccggggaagagtgcgattgcgggtacgacgacaacgaa
tgcgtggataagtgttgttatccaaggcagatatcggatttggataaaatgaagaacgac
acggccaagggttgcaccagaaaatccggaacccaatgcagtcccagccaagggccttgt
tgttcgagcgaatcctgccagttcgttcccctctccaaaaacgttcaatgcaaggctgaa
tccgattgtagttacaattcaacgtgtaacgggcgatcctcagagtgccctccgccgttg
ccaagagccaataagactagatgtaacgagggaactcagttgtgcatcaacggagagtgt
acgggatcgatttgcctggaatggaacttgaccgagtgctttttaacgagtaacgtaatt
ccaaacatcgataaacgtaaactgtgcgaattagcctgccaaaatggaaccgatccatcg
acctgccgtagcaccagcgaatttgcgcacgtagtcggtctacccgaaggtggaatcagc
ctcagacctggatcaccttgtgataattttcaaggatattgtgatgtatttttgaagtgt
agagccgttgacgcagaaggaccattagccagattgaaaaatcttttattcaataaggat
acattgcgtacagtagcacaatggataactgaattctggtgggcggcagtgttaatggga
atagctttcattattttcatggggttgttcatcaagtgctgcgccgttcacactccatcg
agtaatcctaagaaaccaccggccagacgtatcagcgatactctaagaagaccgatgaac
actctgagaagaatgcgacatccacacggaggtggagcaggtcccagaagtatacctccc
agacaaggtcaaggaggacatggtacaaggggaccctctcacggttatggagagggtaga
ggtgctcagtattatccgaaagcaggctatcgctcggttcccacagctagtgcgccaccc
agcggcagcgcagcacccaactacgcccggtccaaccatcccgaattgtacgcaggcgcc
tattcgggctccgggggaggggggagggcctcagcctacgagatgaggcatcacaacaag
gtgtga

DBGET integrated database retrieval system