KEGG   Acyrthosiphon pisum (pea aphid): 100166775
Entry
100166775         CDS       T01076                                 

Definition
(RefSeq) ubiquitin-conjugating enzyme E2-25kD-like
  KO
K04649  ubiquitin-conjugating enzyme (huntingtin interacting protein 2) [EC:2.3.2.23]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:api00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100166775
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:api04121]
    100166775
Enzymes [BR:api01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100166775
Ubiquitin system [BR:api04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100166775
SSDB
Motif
Pfam: UQ_con Prok-E2_B UBA UBA_4 RWD Pox_G7 UEV CUE
Other DBs
NCBI-GeneID: 100166775
NCBI-ProteinID: NP_001155723
APHIDBASE: ACYPI007620
UniProt: C4WVG8
AA seq 199 aa
MNNIATQRIKREFKEVIKSEELAKCSIKVDLIGDSYTELKGEIAGPPDTPYEGGTFFLEI
KVPETYPFNPPKVRFMTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAA
EPDDPQDAVVAKQYKEYPEIFAKTASHWTNVYAGGPNKNSEFDTKIQRLIDMGIERDQAR
GALSTYNWDLERATEQLFS
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaataacattgcgacgcagagaatcaaaagggaatttaaagaagtcattaagagcgaa
gagcttgctaaatgttcaatcaaagtggacttaattggtgatagctatactgaattaaaa
ggtgaaattgctggcccacctgatacaccatatgaagggggtacattctttttggaaatt
aaagtgccagaaacgtatcctttcaatccacctaaagtacgattcatgactaaaatatgg
catccaaatatttcatccgtcactggagctatctgtttagacattttaaaagatcaatgg
gctgcagctatgactttacgcacagtactgttgtctctgcaggcacttatggcagctgct
gaaccagacgatccacaagatgctgttgttgctaaacaatataaagagtatccagaaata
tttgctaaaacagctagccactggactaatgtttatgctggaggtccaaataaaaattca
gaatttgacacaaaaattcagcgtctcatagatatgggaatagaacgtgatcaagcacgc
ggagcattatctacttacaactgggatttggaacgagctacagaacaactttttagttag

DBGET integrated database retrieval system