KEGG   Arabidopsis thaliana (thale cress): AT3G22310
Entry
AT3G22310         CDS       T00041                                 
Symbol
PMH1
Name
(RefSeq) putative mitochondrial RNA helicase 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII CMS1 AAA_19 ERCC3_RAD25_C
Other DBs
NCBI-GeneID: 821800
NCBI-ProteinID: NP_188870
TAIR: AT3G22310
UniProt: Q9LUW6 A0A654FAJ6
Position
3:7887276..7890153
AA seq 610 aa
MISTVLRRSILGTSRRTLAASVTSINAALFHNLAPAAATVSDLANGATNVKSLPSNSSPF
GVKVRDFHVKSVPSEFRSSIVSSAGFAAQEYAPSYENDGGIGDSESVGSSGGGDGLAIAD
LGISPEIVKALKGRGIEKLFPIQKAVLEPAMEGRDMIGRARTGTGKTLAFGIPIIDKIIK
FNAKHGRGKNPQCLVLAPTRELARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGID
VAVGTPGRIIDLMKRGALNLSEVQFVVLDEADQMLQVGFAEDVEIILQKLPAKRQSMMFS
ATMPSWIRSLTKKYLNNPLTIDLVGDSDQKLADGITMYSIAADSYGRASIIGPLVKEHGK
GGKCIVFTQTKRDADRLAFGLAKSYKCEALHGDISQAQRERTLAGFRDGNFSILVATDVA
ARGLDVPNVDLVIHYELPNNTETFVHRTGRTGRAGKKGSAILIHGQDQTRAVKMIEKEVG
SRFNELPSIAVERGSASMFEGVGARSGGSFGGGRSGGGGYGSYGSSSGRSGGGSYGGYGG
SSGRSGGGGGSYGGSGGSSSRYSGGSDRSSGFGSFGSGGSSGGFGSDRSSQSSGRSSFGG
FGSNDGKRSY
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgattagcacagtacttcgccgatctatccttggtacgtcaaggcgtactctcgccgct
tcggtgacctccattaacgcagctctatttcataaccttgctccagccgccgccacagtc
tccgatctagcaaatggagctactaatgtcaagtctctcccttcgaattcgagccctttt
ggtgttaaagtgagagactttcatgttaaatctgtaccgtcggagtttagatcgtcgatt
gtttcttctgcgggattcgcggctcaagagtatgctccttcttatgagaacgatggaggg
attggagattcggagagtgttggtagcagcggtggtggtgatgggcttgcgatagctgat
cttggtatatctccggagattgttaaagctttgaagggtaggggtattgagaaactcttt
cctattcagaaagctgtgttggagccagcgatggagggtcgtgatatgattggccgtgca
aggactggaacgggaaagacacttgcttttgggattcctattattgacaaaatcatcaaa
ttcaacgctaaacatggtcgtgggaagaatcctcagtgcttggttttggcaccgacgagg
gagcttgctcgtcaggttgagaaagagttcagggaatctgctccaagtttggatactatt
tgtctctatggaggtacaccaatcgggcaacaaatgagggagctgaactatggtattgat
gtggcggttggaactcctggtcgtatcattgatctgatgaaaaggggagctttgaatcta
tcagaggttcagtttgtggttcttgatgaagctgatcagatgcttcaagttggatttgcg
gaagatgttgaaataatattgcagaagttgccagcgaagcgtcagagtatgatgttttct
gcaacaatgccaagttggatcagatctctcaccaagaagtacctgaacaatcctttgaca
attgatcttgttggagattcagatcagaaacttgcagatgggattactatgtattctatc
gctgcagattcttatggaagagcatccatcattggtcctcttgtaaaggaacatggcaaa
ggaggaaaatgcattgtctttacccaaacaaaacgtgatgcagatcgccttgcatttgga
ttggcaaaaagctataaatgtgaagctttacacggtgacatatctcaagctcagagagaa
agaacacttgctggtttcagggatgggaatttcagtattcttgttgcaactgatgttgct
gcccgtggacttgatgtacctaatgtcgatttagtaattcattatgagcttcctaataac
acggagacgtttgttcaccgaacggggcgaactggtcgtgctggaaagaaaggaagcgcg
attctcatccacggtcaagatcaaaccagggctgttaaaatgattgagaaagaagtcgga
agcagattcaatgagctgcctagcattgctgtggaaagaggaagcgcaagcatgtttgaa
ggagtaggtgctagatctggtgggtcgttcggaggaggtcgatcaggcggtggtgggtat
ggtagttacggtagcagcagtggccgttcaggtggtggtagttatggaggttatggtggc
agcagtggccgttcaggtggtggtggtggtagttatggaggttcagggggatcaagcagc
cgttactctggtggttcagaccgctcatctggtttcggaagctttggttcaggcggttct
tcaggaggatttggttcagaccgttcttctcagtcaagtggaaggagcagctttggtggg
tttggatcaaacgatggtaaaagatcttactga

DBGET integrated database retrieval system