KEGG   Burkholderia ambifaria AMMD: Bamb_2007
Entry
Bamb_2007         CDS       T00398                                 
Name
(GenBank) AAA ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bam00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bamb_2007
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bam02044]
    Bamb_2007
Enzymes [BR:bam01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Bamb_2007
Secretion system [BR:bam02044]
 Type IV secretion system
  Trb secretion system protein
   Bamb_2007
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB HerA_C AAA_10 TraG-D_C AAA_22 TrwB_AAD_bind CbiA DUF87 T2SSE AAA_16 Zot ABC_tran NACHT FtsK_SpoIIIE RsgA_GTPase
Other DBs
NCBI-ProteinID: ABI87563
UniProt: Q0BE60
Position
1:2202351..2204801
AA seq 816 aa
MLNLAEYRQRPALLADWLPWAGLIAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSA
RLNNALRRLGSGWALFIEAERRPAADYPHSDFPEPLSWLVDEERRAAFEESGHHFESGYH
LTLAHLPPEESRARAAKLLYENAPGDGVDWHGRLDAFVAETDRVFDLLDGVMPEIARLDD
AQTLTYLHATVSTRRYRVGVPEVPFHIDALLADSALVGGLAPTLGDQHLRVVSVRGFPTS
TWPGLLDDLNRLGFAYRWSTRFLCLDKAEAEKELGRLRRQWFAKRKNVVALLRETIFQQE
SPLVDTDASNKAADADAAMQELGGDQVAFGYFTATVTVLDADSAAADEKLRMVERVIQGR
GFVTIPETLNVVDAWLSSIPGNAYANVRQPIVSTLNLAHMMPLSAVWAGPEKNDHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLAILVQQFRRYRGSRVFAFDMGR
SMRATILGLGGEHYDLGADGGIAFQPLARIDRESYRSWAGEWVEGRLLHEGVTVGPDEKA
VIWSALGSLTGAPVEQRTLTGLSVLLQSNALRQALAPYVLGGAHGKLLDADTDRLGFGDV
QGFEMEELMHSPAAVQAVLRYLFARFDERFDGAPTLLILDEAWLFLDEPSFAARIRQWLK
TLRKKNVSVIFATQSLADIKDSSIAPAIIESCPSRIFLPNPQATEPQIRTIYEGFGLNSR
QIEIVATAQPKRDYYYQSRLGNRLFDLDLGPAALAFAGASTPQDQRDMDRVLTQAGAPGF
AGAWLRHRGLDWASDLLPSSPAAASFLNSQPLEVSP
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgctgaaccttgccgaataccgccagcgcccggccttgctcgccgactggcttccgtgg
gccggcttgatcgcgccgggcgtggtgctgaacaaggatggcagtttccagcgtacagcg
cgctttcgcgggcctgatctggacagcgccacgcaaggcgaactgatcgccacatcggcg
cgtctcaacaacgcgcttcgccgcctgggttcgggctgggccctgttcattgaggccgaa
cgccgcccggcggcggactacccgcattccgatttccccgagccgctgtcctggctcgtg
gacgaggaacgccgcgccgccttcgaggaatcggggcatcacttcgagagcggctatcac
ctgacgctggcgcacctgccgcccgaggaatcacgcgcccgcgcggccaagctgctctac
gagaacgcgcccggcgatggcgtggattggcatggccggctcgatgccttcgtggcggaa
accgatcgtgttttcgacttgctcgatggcgtgatgccggagatcgcccggctcgatgac
gcccagacgctgacctacctgcacgccacggtgtccacgcggcgctaccgcgtgggcgta
cctgaagtgccgttccatatcgacgcgctgctggccgactccgcgctggtcggcggcctg
gcgcccacgctgggcgaccagcacctgcgcgtggtgtcggtgcggggctttccgacctcg
acctggccgggcctgctggacgacctcaaccgcctgggctttgcctatcgctggagcacg
cgctttctctgcctggacaaagccgaagcagaaaaggaactcggccgcctgcgccgccag
tggtttgccaagcgcaagaacgtcgtcgcgctgctgcgcgaaaccatcttccagcaggaa
agcccgctggtcgataccgacgcgagcaacaaggcggccgacgcggatgccgcgatgcag
gagctgggtggcgatcaggtcgccttcggttacttcactgccacggtgacggtgctcgat
gccgattcagccgcggccgacgaaaagctgcgcatggtggagcgcgtcatccagggccgg
ggtttcgtgaccatccccgagacgttgaatgtcgtggatgcgtggctgtcgtccatcccc
ggcaatgcctacgcgaatgtccgccagcccatcgtctcgacgctgaacttggcgcacatg
atgccgctgtctgcggtgtgggccgggccggagaagaacgaccacctcgacggcccgccg
ctgatcgtcacccgcaccgatggtgcgacgccgttccggctggtgacacacatcggcgac
gtcggccacacgctggtcgccgggccgaccggcatgggcaagtcggtgttgcttgccatt
ctggtgcagcaattccgccgctatcgcggctctcgcgtgttcgctttcgatatgggccgc
tcgatgcgcgccaccatcctgggcctgggcggcgagcactacgacctgggtgccgatggc
ggcattgccttccagccgctcgcgcgtatcgaccgggaaagctatcgctcctgggcgggg
gaatgggtggaaggccgcctgctgcatgagggcgtgacggtcggcccggacgagaaggcg
gtcatctggtcggcgctgggcagcttgaccggtgcgccggtcgagcaacgcacgttgacc
gggttatcagtactgctgcaatcgaacgcgctacggcaggcactcgcgccttatgtgctc
ggtggcgcgcacggcaagctactggacgcggacaccgatcgtctcggcttcggtgacgta
cagggcttcgagatggaagaactgatgcacagccccgccgccgtgcaagcggtgctgcgc
tacctgttcgcccgcttcgatgagcgtttcgacggtgcgcccacgctgctgattctggat
gaggcgtggctgttcctcgatgagccgtctttcgccgcgcgcattcgccaatggttgaag
acgctgcgcaagaaaaacgtgtcggtgatcttcgccacgcagtcgctcgccgatatcaag
gattcgagcattgcgcccgcgatcatcgagagctgcccgagtcggatttttctccccaat
ccgcaggccaccgagccgcagattcgcacgatctacgagggcttcggcctcaacagccgg
caaatcgaaatcgtcgctaccgcccagcccaagcgcgactactactaccaatcgcgcctc
ggcaatcgcctgttcgaccttgatctgggtccagccgcactcgccttcgcgggtgcatct
actccgcaagaccaacgcgacatggatcgcgtgctgacgcaggccggcgctcccggcttc
gccggtgcgtggctgcgccatcgcggcctcgactgggcctccgacctgttgccgtcctca
ccggcggccgcttcgttcctcaactcccaaccactggaggtttcgccatga

DBGET integrated database retrieval system