KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2353
Entry
Bmul_2353         CDS       T00624                                 
Name
(GenBank) AAA ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bmul_2353
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_2353
Enzymes [BR:bmu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Bmul_2353
Secretion system [BR:bmu02044]
 Type IV secretion system
  Trb secretion system protein
   Bmul_2353
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG HerA_C AAA_10 TraG-D_C AAA_22 TrwB_AAD_bind CbiA DUF87 AAA_16 Zot T2SSE ABC_tran FtsK_SpoIIIE NACHT RsgA_GTPase
Other DBs
NCBI-ProteinID: ABX16038
Position
1:2561438..2563888
AA seq 816 aa
MLNLAEYRQRPALLADWLPWAGLVAPGIVLNKDGSFQRTARFRGPDLDSATQGELIATSA
RLNNALRRLGSGWALFIEAERRPAADYPHSDFPEPLSWLVDEERRAAFEESGHHFESGYH
LTLAYLPPEESRARAAKLLYENAPGDGVDWRGRLDAFVAETDRVFDLLDGVMPEIAWLDD
AQTLTYLYATVSTRRYPVAVPEVPFHIDALLADSALVGGLAPTLGDQHLRVVSVRGFPTS
TWPGILDDLNRLGFAYRWSTRFLCLDKAEAGKELGRLRRQWFAKRKNVVALLRETIFQQE
SPLVDTDASNKAADADAAMQELGSDQVAFGHFTATVTVLDADPAAADEKLRMVERVIQGR
GFVTIPETLNAVDAWLSSIPGNAYANVRQPIVSTLNLAHMMPLSAVWAGPEKNDHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLAILVQQFRRYRGSRVFAFDMGR
SMRATILGLGGEHYDLGADGGIAFQPLARIDRESYRSWAGEWVEGRLLHEGVTVGPDEKA
VIWSALGSLAGAPVEQRTLTGFSVLLQSNALRQALAPYVLGGAHGKLLDADTDRLGFGDV
QGFEMEELMHSPAAVQAVLRYLFARFDERFDGAPTLLVLDEAWLFLDEPSFAARIRQWLK
TLRKKNVSVIFATQSLADIKDSSIAPAIIESCPSRIFLPNPQATEPQIRTIYEGFGLNSR
QIEIVATAQPKRDYYYQSRLGNRLFDLDLGPAALAFAGASTPQDQRDMDRVLTQAGAPGF
AGAWLRHRGLDWAADLLPSSPAATSFLASKPLEISP
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgctgaatcttgccgaataccgccagcggcccgcgctgctggccgactggcttccgtgg
gccggcttggtcgcgccgggcatcgtcttgaacaaggacggttcattccagcgcacggcg
cgctttcgcgggccggatctggacagtgccacgcaaggcgaactgatcgccacttcggcg
cggctcaacaacgcgctgcgccggctgggttcgggctgggccttgttcattgaggccgag
cgccggccggcggcggactacccacactccgactttcccgaaccgctgtcctggctcgtg
gacgaggaacgccgcgcggccttcgaggaatcggggcatcacttcgagagcggctatcac
ctgacattagcttacctgccgccggaggaatcgcgcgcccgcgcggccaagctgctctac
gagaacgcgcccggcgacggcgtggactggcgcggccggctcgatgccttcgtggcggaa
accgatcgcgtcttcgatttgctcgatggcgtgatgccggagatcgcctggctcgatgac
gcccagacgctgacctacctgtacgccacggtgtccacgcggcgctatccggtagccgtg
ccggaggtgccgttccacatcgacgcgctgctggccgactccgcgctggtcggcggcctt
gcgccgacgctgggcgaccagcacctgcgcgtggtgtcggtgcggggctttccgacttcg
acctggccggggattctggacgatctcaaccgcctgggcttcgcctaccgctggagcacg
cgctttctctgcctggacaaagccgaagcgggaaaagagctgggccgcctgcgccgccag
tggttcgccaagcgcaagaacgtggtggcgctgctgcgcgaaaccatcttccagcaggaa
agcccgttggtcgataccgacgccagcaacaaggcggccgacgcggacgcagcgatgcag
gagctgggcagcgatcaggtggccttcggtcacttcactgccacggtgacggtgctcgat
gccgatccggccgcggccgacgaaaagctgcgcatggtggagcgcgtcatccagggccgg
ggtttcgtgaccatccccgaaaccctcaacgccgtcgatgcgtggctgtcgtccatcccc
ggcaacgcttacgccaacgtgcgccagcccatcgtctcgacgcttaacctggcgcacatg
atgccgctgtcggcggtgtgggccgggccggagaagaacgaccacctcgacggcccgccg
ttgatcgtcacccgcaccgatggcgccacgccgttccggctggtgacgcacatcggcgat
gtaggccacacgctggtggccggcccgaccggcatgggcaagtcggtgttgcttgccatt
ctggtgcagcaattccgccgctatcgcggctcacgcgtgttcgcctttgatatgggccgc
tcgatgcgcgccaccatcctgggcctgggcggcgagcactacgacttgggtgccgatggc
ggcattgccttccagccgctcgcgcggatcgaccgggaaagctatcgctcctgggcgggg
gaatgggtggaaggccgtctgctgcatgagggcgtgacggtcggcccggacgagaaggcg
gtcatctggtcggcgctgggcagcttggccggtgctccggtcgagcagcgcacgttgacc
gggttctcggtgctgctgcaatcgaacgcgctacggcaggcactcgcgccctatgtgctc
ggtggcgcgcacggcaagctgctggacgcggacaccgatcgtctcggcttcggtgacgtg
caaggcttcgagatggaagaactgatgcacagccccgccgccgtgcaagcggtgctgcgc
tacctgttcgcccgtttcgatgagcggttcgacggtgcgcccacgctgctggttctggat
gaggcgtggctgttcctcgatgagccttccttcgccgcgcgcattcgccaatggctgaag
acgctgcgcaagaaaaacgtgtcggtgatcttcgccacgcagagtttggcggacatcaag
gattcgagcattgcgcccgcaatcatcgagagctgcccgagtcggatctttctccccaat
ccgcaggcgaccgagccgcagattcgcacgatctacgagggcttcggcctcaacagccgg
caaatcgaaatcgtcgctaccgcccagcccaagcgtgactactactaccaatcgcgcctc
ggcaatcgcctgttcgacctcgacctggggccggcggcgctcgccttcgcgggcgcttcc
acaccgcaagaccaacgcgacatggaccgcgtactgacgcaggccggcgctcccggcttc
gccggcgcgtggctgcgccatcgcggcctcgactgggccgccgacctgctgccgtcctca
ccggcggcgacttctttccttgcttctaaaccgctggagatttcgccatga

DBGET integrated database retrieval system