KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0973
Entry
GBP346_A0973      CDS       T00894                                 
Name
(GenBank) ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GBP346_A0973
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpr02044]
    GBP346_A0973
Enzymes [BR:bpr01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     GBP346_A0973
Secretion system [BR:bpr02044]
 Type IV secretion system
  Trb secretion system protein
   GBP346_A0973
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 HerA_C AAA_22 AAA_16 Chloroa_b-bind DUF87 TraG-D_C CbiA FtsK_SpoIIIE ABC_tran TrwB_AAD_bind NACHT RsgA_GTPase AAA_7 Zot
Other DBs
NCBI-ProteinID: ACQ97499
UniProt: C4KSG5
Position
I:937909..940371
AA seq 820 aa
MLNLAEYRQRPALLADWLPWAGLIASGVVLNKDGAFQRTACFRGPDLDSATQSELIATTA
RLNNALRRLGTGWALFIEAERQPAAEYPHSQFPEPLSWLVDEERRATFEGETADETLRGS
VSRSNGHHFESGYHLTLTYLPPEESRARAAKLLYENVSTPGVDWRERLTAFLAETGRIFD
LLDGVMPELAWLDDGETLTYLHATVSARRYRITVPEVPFYLDALLADAPLIGGLAPMLGD
QHLRVVTVRGFPSSTWPGMLDDLNRLGFAYRWSTRFLCMDKAEAEKELARLRRQWFAKRK
NVLALLRETIFQQESPLVDTDASNKAADADAALQELGSDQVAFGYLTATVTVLDADANVA
DEKLRRVERVIQGRGFVTIPETLNAVEAWLSSVPGNAYANVRQPIVSTLNLAHLMPVSAV
WAGPQNNAHLDGPPLIVTRTEGATPFRLVTHIGDVGHTLVVGPTGMGKSVLLATLAMQFR
RYPGSRILAFDMGRSMRATILGLDGEHYDLGADCAIAFQPLARIDQEGDRTWAAEWIEGR
LRHEGVTVGPDERVAIWSALGSLAGAPVEQRTLTGMSVLLQSNALRQALAPYVLGGAHGK
LLDADHDRLGSADVQCFEMEELMHSRAAVLAVLGYLFARFEARFDGAPTLLILDESWLFL
DDPVFAARIRQWLKTLRKKNVSVIFATQSLADVQNSSIAPAIIESCASRIFLPNPQASEP
QIRTIYEGFGLNARQIEIVATAQPKRDYYYQSRLGNRLFDLDLGPVTLAFAAASTPQDQR
LIDEVSARTSPSGFASAWLRQRGLDWAADLLHPSSQGETP
NT seq 2463 nt   +upstreamnt  +downstreamnt
gtgctgaaccttgccgaatatcgccaacgcccagccctgctggccgactggctgccgtgg
gcaggcttgatcgcatccggcgtggtgctcaataaggacggcgcgttccagcgcacggcg
tgctttcgtgggccggacctggatagcgcgacgcagagtgagctgatcgccacgaccgcg
cggctgaacaacgcactgcggcgacttggcacgggctgggcgctgttcatcgaggccgag
cgccaacctgcggcggagtacccgcactcgcagtttcccgagccgctgtcctggctggtc
gatgaggagcggcgtgccaccttcgagggtgagaccgcagacgaaacgctcagggggagc
gtttcgcggtcgaacggccatcacttcgagagcggctatcacctgacgctgacttacctg
ccgccggaggagtcccgcgcacgtgctgcaaagctgctctatgagaacgtgtccacgccc
ggtgtggattggcgcgagcggttgacggccttccttgccgaaaccggccggattttcgac
ctgctcgatggtgtgatgccggagctcgcgtggctcgatgatggcgagacgctgacctac
ctgcacgcaaccgtctcggcgcgacggtatcgcatcactgtacctgaggtgccgttctac
ctcgacgcgctgctggccgatgcgcctctgatcggcggtctcgcaccgatgctgggcgat
cagcatctgcgcgttgtgaccgtacgcggctttccgtcctcgacgtggccagggatgctg
gacgacctgaatcggctcggttttgcgtatcgctggagtacgcgctttctgtgcatggac
aaggcggaggccgagaaagaactggctcgcttgcgccggcagtggttcgccaagcgcaag
aacgtcctggcgctgctgcgcgaaacgatcttccagcaggagagcccgctggtcgatacc
gatgccagtaacaaggcagccgacgcggatgccgccttgcaggagctgggcagcgatcag
gtcgcgttcggctatctcaccgcgaccgtgacggtgcttgatgccgatgccaacgtggcg
gacgagaagctgcgcagggtggagcgtgtcatccagggacgcggcttcgtcacgattccg
gaaacgctgaacgccgtggaggcatggctgtcatcggtgccaggcaacgcctacgccaac
gtgcgccagcccatcgtctcgacgttgaatctggcccacctgatgccggtgtcggcggtg
tgggccgggccgcagaacaatgcccatcttgacggcccgccgctgatcgtcacgcgcacc
gaaggcgccacgccgttccggctggtgacgcatatcggcgatgtggggcacacgctggtg
gttgggccgaccggcatgggcaagtcagtcttgctggcgacactggcgatgcagtttcgc
cgttatcccggctcgcgcattctggcgttcgacatgggccgctccatgcgcgcaacaata
ctgggcctcgatggcgagcattacgacctgggcgcggattgtgcgatcgcgtttcagccg
cttgcgcgcatcgaccaggagggcgatcgcacctgggccgccgaatggatcgaaggccgt
ttgcggcatgagggcgtcacggtcggcccggacgagcgggtggctatctggtccgcgctc
ggcagtctcgccggcgcgccggttgagcagcgcacgctcaccggcatgtcggtgttgctg
caatccaatgcgctgcggcaggcactcgcaccctatgtgctgggtggcgcgcacggcaaa
ctgctggatgccgaccacgaccggctcggttcggccgacgtgcagtgcttcgagatggaa
gaactgatgcacagcagggccgccgtgctggcggtgctgggctatctgtttgcgcgcttc
gaggcgcgcttcgatggcgcaccgacactgctgattctcgacgaatcctggctcttcctc
gatgacccggtgttcgccgcgcgcatccgccagtggctcaagacactgcgcaagaagaac
gtcagcgtcatttttgccacgcagtcattggccgacgttcaaaattcgagcatcgcgccg
gcgatcatcgagagctgcgcgagtcgcatcttcctgccgaacccgcaggcgagtgagccg
cagattcgcacgatttacgagggttttgggctgaatgcccggcagatcgagatcgtcgcc
accgcacagcccaagcgcgattactactaccagtcgcgtcttggcaaccgcctgtttgat
ctggacctcgggccggtgacgctggccttcgcggcggcttccacaccgcaggatcaacgc
ctcatcgacgaggtgtccgcccgcacttcgccatctggctttgcatcagcatggctacgt
cagcgcggcctggactgggccgccgatctgctccacccgtcatcgcagggagaaacgcca
tga

DBGET integrated database retrieval system