KEGG   Bacillus subtilis subsp. subtilis 168: BSU02250
Entry
BSU02250          CDS       T00010                                 

Symbol
ybfJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2606 CarboxypepD_reg Big_1 SdrD_B DUF4198 Invasin_D3 BIg21 CSD2
Other DBs
NCBI-GeneID: 938435
NCBI-ProteinID: NP_388107
Pasteur: BG12739
BSORF: BG12739
UniProt: O31451 A0A6M4JJM1
Position
246094..246492
AA seq 132 aa
MYSTIFNIGQINKYSKLAIFMSILFLCGCSSQTHSSQKETTIPVTLHVEDAKGLPVEGVQ
VTIVKAPSSDEEPSTEIGEILGKTDKNGDIKWDTGRKGDYSVALTKGETSVTHHISLTED
KKDHAIPLVFKE
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtattcaacaatattcaatattgggcaaatcaataaatacagcaaactagccatattc
atgtctattttgtttttatgcgggtgcagttcgcagacgcattcttctcaaaaagaaacg
actattcctgtcactcttcatgtggaggatgctaaggggctgccggtcgaaggggttcaa
gtgacgattgtcaaagcgccctcttcagatgaggagccgagtacagagattggcgagata
ctcggtaaaacagacaaaaacggagatatcaaatgggataccggcagaaaaggcgattac
tcagtcgcgttgacgaagggtgaaacatcagtaacccatcacatctcgttaacagaggat
aaaaaagatcatgccattccattagtcttcaaagaatag

DBGET integrated database retrieval system