KEGG   Bacillus subtilis subsp. subtilis 168: BSU05370
Entry
BSU05370          CDS       T00010                                 

Symbol
ydfD
Name
(RefSeq) GntR family transcriptional regulator
  KO
K18907  GntR family transcriptional regulator, regulator for abcA and norABC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00700  Multidrug resistance, efflux pump AbcA
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU05370 (ydfD)
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bsu01504]
    BSU05370 (ydfD)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    BSU05370 (ydfD)
Antimicrobial resistance genes [BR:bsu01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AbcA [MD:M00700]
    BSU05370 (ydfD)
   Multidrug resistance, efflux pump NorB [MD:M00702]
    BSU05370 (ydfD)
SSDB
Motif
Pfam: Aminotran_1_2 GntR Asp_aminotransf HTH_Crp_2 HTH_36 HTH_11 HTH_41 HTH_24 MarR
Other DBs
NCBI-GeneID: 939903
NCBI-ProteinID: NP_388418
Pasteur: BG12151
BSORF: BG12151
UniProt: P96681 A0A6M3ZB25
Position
583589..585037
AA seq 482 aa
MSFPEEKKMKKLPKYRQIVHFIKEKIGNGEWPIGSKIPSQRTLAKDFQVNRSTVITALEE
LMADGLIEGTMGKGTVVINNTWTLMAKNSAPDWDQYVTSGIQMPSRKIVQEINQSESNTD
LIQLSKGELSAEIFPLAVMKEMMGKVSQHMEAFGYEEPKGYLPLREALSNYLKTIGINVS
SSSILIVSGALQALQLISMGLLQRGSTVYLDQPSYLYSLHVFQSAGMKLTGLPMDNEGLL
PENVHLTRGERGRAILYTNPCFHNPTGILMSKKRREEILAVSENTQLPIIEDDIYRELWI
DEIPPYPIKTIDKNGHVLYIGSLSKTLSPGLRIGWIVGPEPVIERLSDIKMQTDYGSSSL
SQRVAAEWFTSGHYQQHVEKVRQQLKVRRELALSALETHLKEVATWNIPKGGFFVWIKIL
PSISMKLLYTKALSKGILINLGSIYAQEKGNYIRLSYAYASLEDLQKGIYELGLMIKELA
SR
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgagctttccagaagaaaaaaagatgaaaaagctccctaagtacagacaaatcgttcat
tttattaaagagaaaataggaaatggagagtggccgattggaagcaagattccaagccag
cgcacgcttgcaaaagattttcaggtaaatcggagcacagtgattacagcgttagaggaa
ttgatggccgatgggctaatagaaggcacaatggggaaaggcacagttgttatcaacaac
acatggacactgatggctaagaattctgctcccgattgggatcaatatgtcacctctggc
attcagatgccaagccgaaaaatcgttcaagagataaatcaatcagaatcaaatacagac
cttatacagctcagtaaaggtgaactttcagctgagatttttcctttggctgttatgaaa
gagatgatggggaaggtatctcaacacatggaggcattcggatatgaagaaccaaaaggt
tacttacctttgagggaggcattaagcaactatttaaaaaccattggaatcaacgtctca
tcttcttccattctgattgtctcaggagcgttgcaagccttgcagctgatatcaatgggg
ctgttacaaagaggatcaaccgtttatcttgatcagccctcctacctttattcattacac
gtatttcaatcagctggtatgaagctgactggacttcctatggataatgaaggacttttg
cctgaaaatgttcatttaacaagaggagagcggggaagggctatcttatatacaaatcca
tgttttcacaatccgactggtattcttatgtctaaaaagcgacgggaagaaatcctagca
gtaagtgagaatacacagcttcctattattgaagatgacatttatcgtgagttatggatc
gatgaaattccgccatatcctattaaaacaattgataaaaatggacacgtactgtacata
ggaagtttatcgaaaacattaagcccaggtttgaggattggatggatcgtcggaccggaa
ccggtgattgaacgtttatctgacattaaaatgcaaacagattacggatccagttcgcta
tcccagagagtagcggcagagtggtttacttccggccactaccagcagcatgtagaaaag
gttaggcagcaattaaaggtgagaagagaattggccttgagtgctttagaaactcatttg
aaagaagtggcgacatggaatatcccaaaaggagggttttttgtctggataaaaatattg
ccttccatatcaatgaaattactttatactaaagccttatcaaaagggattctgatcaat
ctcggcagtatctatgctcaggaaaaagggaattatattcgcttatcatatgcttatgca
tctcttgaagaccttcaaaaggggatttatgagttgggtttaatgattaaagaattggca
agcaggtaa

DBGET integrated database retrieval system