KEGG   Bacillus subtilis subsp. subtilis 168: BSU05950
Entry
BSU05950          CDS       T00010                                 

Symbol
ydiF
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K06158  ATP-binding cassette, subfamily F, member 3
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bsu03012]
    BSU05950 (ydiF)
Translation factors [BR:bsu03012]
 Eukaryotic type
  Initiation factors
   Initiation associated factors
    BSU05950 (ydiF)
SSDB
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 SMC_N ABC_tran_CTD AAA_22 RsgA_GTPase AAA_29 MMR_HSR1 RNA_helicase AAA_16 AAA_15 NACHT AAA_23 AAA_14 TsaE NB-ARC AAA AAA_30 Rad17 NTPase_1 AAA_33 AAA_7 Roc AAA_25 AAA_24 DUF5906 FtsK_SpoIIIE MukB PduV-EutP ATPase_2 Dynamin_N Septin MeaB AAA_10 DUF87 DUF6697
Other DBs
NCBI-GeneID: 938013
NCBI-ProteinID: NP_388476
Pasteur: BG12203
BSORF: BG12203
UniProt: O05519 A0A6M4JDF6
Position
complement(644528..646456)
AA seq 642 aa
MMILQVNQLSKSFGADTILNNIKLEVRNRDRIAIVGRNGAGKSTLLKIIAGQLSYEKGEI
IKPKDITMGYLAQHTGLDSKLTIKEELLTVFDHLKAMEKEMRAMEEKMAAADPGELESIM
KTYDRLQQEFKDKGGYQYEADVRSVLHGLGFSHFDDSTQVQSLSGGQKTRLALGKLLLTQ
PDLLILDEPTNHLDIDTLTWLEHYLQGYSGAILIVSHDRYFLDKVVNQVYEVSRAESKKY
HGNYSAYLDQKAAQYEKDLKMYEKQQDEIAKLQDFVDRNLARASTTKRAQSRRKQLERMD
VMSKPLGDEKSANFHFDITKQSGNEVLRVQDLTISYENQPPLLTEVSFMLTRGESAALVG
PNGIGKSTLLKTLIDTLKPDQGTISYGSNVSVGYYDQEQAELTSSKRVLDELWDEYPGLP
EKEIRTCLGNFLFSGDDVLKPVHSLSGGEKARLALAKLMLQKANFLILDEPTNHLDLDSK
EVLENALIDYPGTLLFVSHDRYFINRIATRVLELSSSHIEEYLGDYDYYTEKKTEQLELE
KMNQQEETDKTPATVKSDSKRSYEEEKEWKKKERQRLRRIEEIETTVQTIEENISRNDEL
LCDPEVYQDHEKVQAIHADNEKLNQELESLLSEWEELSTEED
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgatgatcttacaagttaatcagctgtccaaatcatttggtgctgatactattttaaac
aatataaagctggaagtcagaaatcgtgatcgcatcgccattgtaggaagaaatggcgcc
ggaaaatccacgctccttaaaattatcgcaggccagctttcgtatgaaaagggcgaaatt
attaaaccgaaagatattacaatgggatatctcgcccagcatactggcttggattctaag
cttaccataaaagaagagctgctgactgtttttgaccacttaaaagcaatggaaaaggaa
atgcgggctatggaagaaaaaatggcggcagctgacccgggtgaattagaaagcatcatg
aaaacctacgaccgtcttcagcaggaattcaaagataaaggcggttatcaatatgaagcg
gatgttagatctgtgctgcatggtctcggcttcagccattttgacgattctacacaggtt
caaagcctcagcggaggccagaaaacaagactggctttaggtaagcttctattaacacag
cctgatttgctcattcttgatgagccgacaaaccatctggatattgatacgcttacctgg
cttgagcattatttacaaggctattcaggcgccattctcatcgtttcgcatgaccgctac
tttttggacaaagtagtaaaccaggtatacgaggtatcaagagcagaaagcaaaaagtat
cacggcaactacagcgcttatctcgaccaaaaagccgcgcagtatgaaaaagatctgaaa
atgtatgaaaagcagcaggacgagattgcaaagctgcaggacttcgtagatcgaaatctg
gcgagagcctctaccaccaaaagggcgcaaagccgcagaaagcagcttgagcgaatggat
gtcatgtcaaaaccgcttggcgatgaaaaatccgcaaactttcattttgatattacaaaa
cagagcggaaatgaagtccttcgtgttcaggatctcacaatcagctatgaaaaccagccg
ccgcttttaacagaagtgtcattcatgctcacaagaggagaaagcgctgcgcttgtcggc
cctaacggaataggtaaatcgacattgctgaaaacattaatagacaccctaaaaccagat
cagggaacaatttcttacggctcaaatgtcagtgtcggctattatgaccaggaacaggct
gagttgacttcctctaaacgtgtccttgatgagctgtgggacgagtaccccgggctccca
gaaaaagaaatcagaacgtgtctcggaaatttcttattctccggagatgatgtgctgaaa
ccagttcattcactgagcggaggcgaaaaagcaagattggctctagctaagctgatgctt
caaaaagccaactttctcatccttgatgaaccgacgaaccatctggatttagacagcaaa
gaagttctcgaaaacgcgctgattgattatccaggcacactgttatttgtctcacatgac
agatattttattaacagaatcgccacaagagtattggagctttcttcaagccatatagag
gagtatctgggagattacgattattatacagagaaaaaaacagagcagcttgaattggag
aaaatgaatcagcaagaggaaactgataaaacgccagctacagtgaagtctgactccaaa
cgttcctacgaggaagaaaaagaatggaaaaagaaagagcgccaacgactccgtcggatt
gaagaaattgaaaccaccgttcaaaccattgaggagaacatcagccgcaatgatgaattg
ctatgtgaccctgaagtctatcaggatcatgaaaaagtacaagctatccatgcagacaat
gagaagcttaatcaggagctggaatctcttttgtccgaatgggaagaactatccacagaa
gaagattaa

DBGET integrated database retrieval system