KEGG   Bacillus subtilis subsp. subtilis 168: BSU07490Help
Entry
BSU07490          CDS       T00010                                 

Gene name
yfmF
Definition
(RefSeq) Fe(3+)-citrate import ATP-binding protein YfmF
  KO
K23184  ferric citrate transport system ATP-binding protein [EC:7.2.2.18]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU07490 (yfmF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU07490 (yfmF)
Enzymes [BR:bsu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.18  ABC-type ferric citrate transporter
     BSU07490 (yfmF)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Ferric citrate transporter [MD:M00871]
    BSU07490 (yfmF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_15 SMC_N AAA_29 AAA_16 AAA_22 ABC_ATPase AAA_25 AAA_23 AAA_28 SRP54 DUF2813 AAA_30 AAA_14 AAA_5 RsgA_GTPase DUF815 NACHT Rad17 ATP-synt_ab AAA_18 AAA Mg_chelatase AAA_33 Viral_helicase1 MukB RNA_helicase G-alpha Zeta_toxin AAA_7
Motif
Other DBs
NCBI-GeneID: 936117
NCBI-ProteinID: NP_388630
Pasteur: BG12957
BSORF: BG12957
UniProt: O34510
Position
complement(822903..823703)
Genome map
AA seq 266 aa AA seqDB search
MGKLAADQLTLSYDSTVIIDGVDLKIEEGKITALIGANGCGKSTILKSLARLMAPKSGTV
LLEGKDIHRQPSKEVAKKLAILPQSPQAPEGLTVEELCYFGRHPHKKLLSKHTQEDHDMV
EWALEATGMIELKDRTLDALSGGQRQRAWISMALAQGTDLLLLDEPTTYLDISHQIEVLE
LLKKLNRDHGRTVVMVLHDLNQAAQYADYLISVLDGKIYNAGTPEDVFTQPFFREVFGLE
CCIMRSPIDQKPMCLPTGLCPKLRAK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaactggctgcagaccagctcactctttcatatgacagtacagtgattattgac
ggagtcgacttaaagatagaagaaggaaaaatcactgcgctcatcggcgctaatggctgc
ggtaaatcaacaatcctcaaatcgctcgccaggctgatggccccaaaaagcggtacagtg
ctactagaaggaaaagacatccaccgccagccatcaaaagaagtcgcaaaaaaactggcc
attcttccacaatctcctcaggctcctgaaggattgacggtagaggaattatgctatttt
ggcagacatcctcacaaaaagctgttatccaagcatacccaagaggatcatgacatggta
gagtgggcgctggaagcaacgggcatgattgaactgaaggatcggacacttgatgccctc
tcaggcggccaaagacaaagagcctggatttccatggcacttgcgcaaggcactgatttg
cttttgcttgatgagccgaccacgtatttagacatctcacatcagattgaagtgcttgaa
ctgctgaaaaagctgaaccgcgaccatggccgcaccgttgtcatggtgctccatgattta
aaccaagccgctcaatatgctgactatctgatcagtgtgctggacggaaaaatatacaac
gccggaacaccggaagatgtgttcacccagccatttttccgtgaagtcttcggcttggaa
tgctgcatcatgagaagcccgatcgaccagaagccaatgtgcctgccgacgggactgtgc
ccgaaattacgggcgaaatga

DBGET integrated database retrieval system