KEGG   Bacillus subtilis subsp. subtilis 168: BSU09140
Entry
BSU09140          CDS       T00010                                 

Symbol
yhcM
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFMR_assoc EOS1 Presenilin TFIIA Zip
Other DBs
NCBI-GeneID: 939279
NCBI-ProteinID: NP_388795
Pasteur: BG11591
BSORF: BG11591
UniProt: P54597 A0A6M3Z8V2
Position
complement(988417..988872)
AA seq 151 aa
MLFNQRRGISPAALIIGSTMLITALSPQIRQRISGFITGQMNRRNSENNTFDASNVGNMV
KQAFSGSSGSSGDNQDRSQHQSQRQNGRQHQHAGQQQPQHQHTQSQTRQTETAAKKRQPH
YAEPIHFEQNAMNVMDDNTMMEMLEDLEPGR
NT seq 456 nt   +upstreamnt  +downstreamnt
atgttgttcaaccagcgaagaggaatcagccccgcagcattgatcataggatcaactatg
cttattactgcattatcacctcagatccgccaaagaatcagcgggtttatcacaggacaa
atgaacagacgaaattcagaaaataacacgtttgatgcttctaatgtaggaaacatggtc
aaacaagcatttagcggaagcagcggaagcagcggtgataaccaggaccgttcgcagcat
caaagccagcggcaaaatggccgtcagcaccagcacgctggacagcagcaaccacagcat
cagcatacacagtctcaaactaggcaaactgagacagccgcgaaaaaaagacagccgcat
tatgctgaacccattcattttgaacaaaacgcaatgaatgtcatggacgacaacacgatg
atggaaatgctggaggacttagagcctggccgttaa

DBGET integrated database retrieval system