KEGG   Bacillus subtilis subsp. subtilis 168: BSU10560
Entry
BSU10560          CDS       T00010                                 

Symbol
yhjM
Name
(RefSeq) NTD biosynthesis operon regulator NtdR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_38 HTH_Tnp_ISL3 HTH_7 Lipoprotein_7 HTH_23 HTH_3 HTH_36 MarR_2 HTH_17 HTH_29 HTH_Crp_2 HTH_24
Other DBs
NCBI-GeneID: 936344
NCBI-ProteinID: NP_388937
Pasteur: BG13079
BSORF: BG13079
UniProt: O07567 A0A6M3Z972
Position
1129715..1130704
AA seq 329 aa
MPTIDEIAKLCNVSKTTVSRVLNNHPYVSKEKRDMILKAINELDYTPNYLARNFRRNKTQ
TIALSVPSIDHPFFAQLIKGVSHEVLFKNYKVIVFQTFYDKQTELELLELLKHKEVDGII
LGTLENEWDQISPFLKYGPILLCNEYHHSADITIIGYDEFEAAYMGVVHLIERGHKKIGF
CFDTPYSEAQCQRKEGYLKALQDYNLHHRSEWIFGEMFNIEDGFRVFHKIKDLKDRPSAI
FTGNDQVAAGIIKQAMKNGFKVPEDLAVIGFDNQLICQVVTPTITTIDIPVIELGQQAVL
KIIESISGNASLNRRIIKLPTKLIIREST
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcctacaattgatgaaatagcaaaattatgcaatgtgtctaaaaccacagtgtcaaga
gtattgaataatcatccttatgtgtcgaaagaaaaaagagatatgatcttaaaggctatt
aacgaacttgactacactcccaattatttagctcggaattttaggagaaataagacacaa
acgatagctttatcggttccgagtatcgaccatccattttttgctcaattaataaaaggg
gtctctcatgaagtactgtttaagaattacaaggtaattgtatttcagaccttttatgac
aaacagacggagctagaattactagagttattgaagcataaagaagtggatggcattatt
cttgggactttagaaaatgaatgggatcagatatcccctttcttaaagtatggtcctatc
ttattatgtaatgaatatcatcactcagcggacatcacgataattgggtatgatgaattt
gaagccgcatacatgggggtagtacatttaattgaaagagggcataaaaaaattgggttt
tgttttgatactccatatagcgaagctcaatgtcagaggaaagagggttatttgaaagct
ttacaagattacaatttacatcatagaagcgaatggatattcggcgaaatgtttaatatc
gaggatggctttcgtgtttttcataagataaaggatctaaaggacagaccctcagcaata
tttacaggaaatgatcaagtcgccgcagggattattaaacaggcgatgaaaaatggcttt
aaagttccagaagacttagctgtaattggttttgacaaccaattgatttgccaagtcgtt
actccgaccataacaacaattgatatccccgtaatagaattaggccaacaggctgtgttg
aaaatcatcgagtccatttcgggtaatgcctctttaaacagaagaattattaaactgcca
acaaagcttattataagagaatcaacgtaa

DBGET integrated database retrieval system