KEGG   Bacillus subtilis subsp. subtilis 168: BSU11820
Entry
BSU11820          CDS       T00010                                 

Gene name
yjcD
Definition
(RefSeq) ATP-dependent DNA helicase
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03420  Nucleotide excision repair
bsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    BSU11820 (yjcD)
   03430 Mismatch repair
    BSU11820 (yjcD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU11820 (yjcD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BSU11820 (yjcD)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BSU11820 (yjcD)
   MMR (mismatch excision repair)
    Other MMR factors
     BSU11820 (yjcD)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 Viral_helicase1 AAA_30 AAA_12 Exonuc_V_gamma AAA_14 ResIII
Other DBs
NCBI-GeneID: 939813
NCBI-ProteinID: NP_389064
Pasteur: BG13157
BSORF: BG13157
UniProt: O31626 A0A6M3Z9J8
Position
complement(1253713..1255866)
AA seq 717 aa
MLRLNIADPPEFIHRQPGDFPACEEACEPKPSKEGKKEDDQESGVIRLPKGKAIAADPSP
AVTEWHRPRSIKPGTPFVPKTIEPDTSLFPSVGLNTDQLKAVTETEGPLLVLAGAGSGKT
RVLTARAAHMIEHLGIPPENMLLVTFTTKAVAEMKERMANQYGLQPAKVRRIVTGTFHSL
FYKILYHSNSAKWNGEHLLKMEWQREQYIKKALYEEGIDEKESPVDQALQQIGFWKNTYV
PNERIPLKDEWEKQVYRLYEHYERQKKEHSQFDFDDMASACYELFIERPDLLEQYQSRFT
YILIDEFQDINPVQYKIMQMLASPEQNLCCVGDDDQSIYAFRGSNPSFILDFQKDYPGAK
TIYLTANYRSTHPIVSSADIVVKKNKNRYAKTLEAARDDIQVPVLFYPYDEEEEATMVVS
DIKEKIQNGASPEDFAVLYRTNSGGRAIYERLHQSSIPYTADRGVQSFYSRRIVRQILAY
LYASQNEDDTEAIKHLLPALFLKQSALNTLKALSITEDCTMIKALAKLPDLKPFQLDKIK
KIVPFFASLRTMKPVEAITFAEGKMGFSEYLKKRGNEGNKLEKGSDDLRDIKVVAKKFKT
IPDFLAHVDHMRAAEKNRTDEHGVQLMTIHRSKGLEFKTVYVLGTVDGSIPHDFSLETAR
KGDEAALEEERRLLYVAMTRAKQHLYLSCPANRRGKTANRSRFLYPLLQKARQPLHH
NT seq 2154 nt   +upstreamnt  +downstreamnt
ttgttacggcttaacatcgccgatccgccagagtttatccatcgccagccaggcgatttt
ccggcatgtgaggaggcgtgcgaaccgaagccctctaaagaggggaaaaaagaagatgat
caggaatctggtgtcattcgtttacccaagggaaaagcgatcgccgctgacccgtcccca
gctgttacagaatggcaccgtcctagaagcattaaaccaggaacaccatttgtgccaaaa
acaatagaacccgatacgagcctttttccgtctgtcggtttaaacacggatcagctgaaa
gctgtcacggaaacagagggcccgctcctcgtgcttgcaggtgcggggagcggaaaaaca
cgggtactgacagcccgtgccgcccacatgatcgaacacttaggcataccgcctgaaaat
atgctgcttgtcacctttacaacaaaagctgtcgctgaaatgaaagagcgtatggcgaac
cagtacggattacagccggcaaaagtcagaagaattgtgacaggaacattccacagtctg
ttttataagatcttgtatcactctaattctgctaaatggaacggtgagcatctgctgaaa
atggagtggcagcgggaacaatatatcaaaaaagcactctatgaagaaggcatcgatgag
aaagaatccccagttgaccaagccctgcagcagatcggtttttggaaaaacacttatgtc
ccaaatgaacgcatccctctaaaagatgagtgggaaaaacaagtttatcgtttatatgaa
cattatgaacgccagaaaaaagaacacagccaatttgattttgatgacatggcttcagcc
tgctatgaattgtttatcgagcggcctgaccttctggaacaatatcaatctcggtttacg
tatatcttaattgatgagtttcaggacattaatccggttcaatacaaaatcatgcaaatg
ctcgccagcccggagcaaaacctgtgctgtgtcggagacgatgaccagtccatctacgcg
tttcgcggaagcaatccgtctttcattcttgattttcaaaaggattatccgggagcgaag
acgatctatttaactgcgaactacaggtctacgcacccgatcgtctctagtgctgatatc
gttgtgaaaaagaacaaaaacagatatgccaaaacgcttgaagcggcccgcgatgacatt
caggtccctgtgctgttttatccttatgatgaagaggaagaagccacaatggtcgtttcc
gatatcaaagaaaaaattcaaaatggagccagtccagaagactttgcggttctttaccgc
acaaacagcggaggccgtgctatatatgaaaggcttcatcaatcgtcaattccgtataca
gctgaccgcggcgtccaatcgttttacagcagacggatcgtccgccagattctcgcctac
ttgtacgccagccaaaatgaggatgacaccgaggcgattaaacacttgcttcccgccttg
tttttaaaacagtccgctttgaatacgctgaaggcgctctcgattacagaggactgtacc
atgatcaaagcgctggccaaattgcctgatctgaagccattccagctggacaaaatcaag
aaaatcgtaccgttttttgcaagcctccgcacaatgaaacccgtagaagccatcaccttt
gcagaaggaaaaatgggcttctccgagtatttaaaaaagcggggcaatgagggcaacaag
ctggaaaaaggctctgatgacctgcgcgacatcaaggttgtcgccaagaagttcaaaacg
attcctgactttcttgcccacgtagaccatatgagggccgctgagaaaaacagaacggat
gaacatggcgttcagctgatgaccattcaccggtcaaaaggccttgaattcaaaacagtc
tacgtgttaggcactgtagatggctcgattccgcacgatttctcattagaaacggcaaga
aaaggagacgaggccgctcttgaggaggaaagacgccttttatatgtagccatgacccgg
gcgaaacagcatttatatttgtcttgccctgctaacaggcgcggcaaaacagccaaccgc
tcaagatttttgtatcccctgctacagaaagcaagacagcccttgcatcattaa

DBGET integrated database retrieval system