KEGG   Bacillus subtilis subsp. subtilis 168: BSU11820Help
Entry
BSU11820          CDS       T00010                                 

Gene name
yjcD
Definition
(RefSeq) ATP-dependent DNA helicase
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03420  Nucleotide excision repair
bsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    BSU11820 (yjcD)
   03430 Mismatch repair
    BSU11820 (yjcD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU11820 (yjcD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BSU11820 (yjcD)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BSU11820 (yjcD)
   MMR (mismatch excision repair)
    Other MMR factors
     BSU11820 (yjcD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 Viral_helicase1 AAA_30 AAA_12 AAA_14 Exonuc_V_gamma AAA_16 AAA_11 ResIII
Motif
Other DBs
NCBI-GeneID: 939813
NCBI-ProteinID: NP_389064
Pasteur: BG13157
BSORF: BG13157
UniProt: O31626
Position
complement(1253713..1255866)
Genome map
AA seq 717 aa AA seqDB search
MLRLNIADPPEFIHRQPGDFPACEEACEPKPSKEGKKEDDQESGVIRLPKGKAIAADPSP
AVTEWHRPRSIKPGTPFVPKTIEPDTSLFPSVGLNTDQLKAVTETEGPLLVLAGAGSGKT
RVLTARAAHMIEHLGIPPENMLLVTFTTKAVAEMKERMANQYGLQPAKVRRIVTGTFHSL
FYKILYHSNSAKWNGEHLLKMEWQREQYIKKALYEEGIDEKESPVDQALQQIGFWKNTYV
PNERIPLKDEWEKQVYRLYEHYERQKKEHSQFDFDDMASACYELFIERPDLLEQYQSRFT
YILIDEFQDINPVQYKIMQMLASPEQNLCCVGDDDQSIYAFRGSNPSFILDFQKDYPGAK
TIYLTANYRSTHPIVSSADIVVKKNKNRYAKTLEAARDDIQVPVLFYPYDEEEEATMVVS
DIKEKIQNGASPEDFAVLYRTNSGGRAIYERLHQSSIPYTADRGVQSFYSRRIVRQILAY
LYASQNEDDTEAIKHLLPALFLKQSALNTLKALSITEDCTMIKALAKLPDLKPFQLDKIK
KIVPFFASLRTMKPVEAITFAEGKMGFSEYLKKRGNEGNKLEKGSDDLRDIKVVAKKFKT
IPDFLAHVDHMRAAEKNRTDEHGVQLMTIHRSKGLEFKTVYVLGTVDGSIPHDFSLETAR
KGDEAALEEERRLLYVAMTRAKQHLYLSCPANRRGKTANRSRFLYPLLQKARQPLHH
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
ttgttacggcttaacatcgccgatccgccagagtttatccatcgccagccaggcgatttt
ccggcatgtgaggaggcgtgcgaaccgaagccctctaaagaggggaaaaaagaagatgat
caggaatctggtgtcattcgtttacccaagggaaaagcgatcgccgctgacccgtcccca
gctgttacagaatggcaccgtcctagaagcattaaaccaggaacaccatttgtgccaaaa
acaatagaacccgatacgagcctttttccgtctgtcggtttaaacacggatcagctgaaa
gctgtcacggaaacagagggcccgctcctcgtgcttgcaggtgcggggagcggaaaaaca
cgggtactgacagcccgtgccgcccacatgatcgaacacttaggcataccgcctgaaaat
atgctgcttgtcacctttacaacaaaagctgtcgctgaaatgaaagagcgtatggcgaac
cagtacggattacagccggcaaaagtcagaagaattgtgacaggaacattccacagtctg
ttttataagatcttgtatcactctaattctgctaaatggaacggtgagcatctgctgaaa
atggagtggcagcgggaacaatatatcaaaaaagcactctatgaagaaggcatcgatgag
aaagaatccccagttgaccaagccctgcagcagatcggtttttggaaaaacacttatgtc
ccaaatgaacgcatccctctaaaagatgagtgggaaaaacaagtttatcgtttatatgaa
cattatgaacgccagaaaaaagaacacagccaatttgattttgatgacatggcttcagcc
tgctatgaattgtttatcgagcggcctgaccttctggaacaatatcaatctcggtttacg
tatatcttaattgatgagtttcaggacattaatccggttcaatacaaaatcatgcaaatg
ctcgccagcccggagcaaaacctgtgctgtgtcggagacgatgaccagtccatctacgcg
tttcgcggaagcaatccgtctttcattcttgattttcaaaaggattatccgggagcgaag
acgatctatttaactgcgaactacaggtctacgcacccgatcgtctctagtgctgatatc
gttgtgaaaaagaacaaaaacagatatgccaaaacgcttgaagcggcccgcgatgacatt
caggtccctgtgctgttttatccttatgatgaagaggaagaagccacaatggtcgtttcc
gatatcaaagaaaaaattcaaaatggagccagtccagaagactttgcggttctttaccgc
acaaacagcggaggccgtgctatatatgaaaggcttcatcaatcgtcaattccgtataca
gctgaccgcggcgtccaatcgttttacagcagacggatcgtccgccagattctcgcctac
ttgtacgccagccaaaatgaggatgacaccgaggcgattaaacacttgcttcccgccttg
tttttaaaacagtccgctttgaatacgctgaaggcgctctcgattacagaggactgtacc
atgatcaaagcgctggccaaattgcctgatctgaagccattccagctggacaaaatcaag
aaaatcgtaccgttttttgcaagcctccgcacaatgaaacccgtagaagccatcaccttt
gcagaaggaaaaatgggcttctccgagtatttaaaaaagcggggcaatgagggcaacaag
ctggaaaaaggctctgatgacctgcgcgacatcaaggttgtcgccaagaagttcaaaacg
attcctgactttcttgcccacgtagaccatatgagggccgctgagaaaaacagaacggat
gaacatggcgttcagctgatgaccattcaccggtcaaaaggccttgaattcaaaacagtc
tacgtgttaggcactgtagatggctcgattccgcacgatttctcattagaaacggcaaga
aaaggagacgaggccgctcttgaggaggaaagacgccttttatatgtagccatgacccgg
gcgaaacagcatttatatttgtcttgccctgctaacaggcgcggcaaaacagccaaccgc
tcaagatttttgtatcccctgctacagaaagcaagacagcccttgcatcattaa

DBGET integrated database retrieval system