KEGG   Bacillus subtilis subsp. subtilis 168: BSU12790
Entry
BSU12790          CDS       T00010                                 

Gene name
xhlA
Definition
(RefSeq) phage-like element PBSX protein XhlA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: XhlA DUF4515 DUF2730 DUF16 Baculo_PEP_C ATG14 Tropomyosin_1 APG6_N DUF3450 PspB DUF1664 GP41 TolA_bind_tri DUF5595 DUF641 NPV_P10
Other DBs
NCBI-GeneID: 936210
NCBI-ProteinID: NP_389162
Pasteur: BG10960
BSORF: BG10960
UniProt: P39798 A0A6M4JHC6
Position
1346731..1347000
AA seq 89 aa
MQQEADVNVFQQDLADMKGEHKALEQRVSALERVSDRQDQQIMTLNEKLNKIEENTTWIK
RTITGAIITAVSTGIIGGAIAIMYSLLQH
NT seq 270 nt   +upstreamnt  +downstreamnt
atgcagcaagaggcagacgtgaatgtgtttcagcaggatttagcagacatgaaaggcgag
cacaaagcacttgagcagagggtttccgcattagaacgcgtgtctgaccggcaagaccag
caaatcatgacgctgaacgaaaaattaaacaaaattgaagaaaacaccacgtggattaaa
cgcaccatcacaggtgccatcattacagcagtgtctacaggcatcattggcggagccatc
gccattatgtacagcctgctgcagcattaa

DBGET integrated database retrieval system